Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7415
Gene name
LocationContig_93:736..2059
Strand-
Gene length (bp)1323
Transcript length (bp)1323
Coding sequence length (bp)1323
Protein length (aa) 441

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11790 Glyco_hydro_cc Glycosyl hydrolase catalytic core 1.6E-52 201 434

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q09788|ASL1_SCHPO Alkali-sensitive linkage protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=asl1 PE=1 SV=1 198 434 2.0E-15

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7415
MFTSKMIVLAALASLAGQAVAFNSHRHLHRRMVGGHKAGATHWVTVYETQYTTVYDQEPTGASKPEANAVYAPEP
AKPTPKPAEKPVHYKSEAPAKPPAPAYKPAPPPAPQAPAPARPAPARPAPAPPAPVEPKAPAVGPSRSEEPPKTT
LEVLPKPVASLLQPAAPYVPPVAPVIPSIGPSSPSGPSHGSSGSPFSGKRGLAYNEAGLANKFNGQCNDCAPWAY
NWGSSPQGLSPDTSYVPMMWGNKPAAVSNWHSDAQKALSNGCKAMLSINEPDNAGQANMSPQDAAEFHVRYMNPY
GGKALIGSPAVTNSGQGGQGIEWLSAFIKACDALPDKCVVDFCVVHWYSPPEYSDTLFDHIKKAHDVCGGKPVWL
TEFGPVDAGGQPMNSPDFFKSVVPKLDAIEYLHAYAPFMCSSGKLMSSPNEISLMGKAYAGIPLL*
Coding >Ophun1|7415
ATGTTCACCAGCAAGATGATCGTCCTCGCCGCCCTCGCCTCTCTGGCTGGGCAGGCCGTCGCCTTCAACTCCCAC
CGCCATCTTCATCGCCGCATGGTTGGCGGGCACAAGGCCGGCGCCACTCACTGGGTCACCGTCTATGAGACTCAG
TACACGACCGTCTACGATCAAGAGCCCACCGGAGCCTCCAAGCCGGAAGCCAACGCCGTTTACGCCCCCGAACCC
GCCAAGCCGACCCCAAAGCCGGCCGAGAAGCCGGTGCACTACAAGTCGGAGGCTCCCGCCAAGCCGCCCGCTCCC
GCCTACAAGCCCGCTCCCCCTCCGGCTCCACAGGCTCCGGCCCCTGCTCGCCCTGCCCCTGCTCGCCCTGCTCCG
GCTCCCCCTGCCCCGGTCGAGCCCAAGGCTCCGGCCGTGGGGCCTTCTCGGTCTGAGGAACCGCCCAAGACGACG
CTCGAGGTTCTGCCCAAGCCAGTTGCTTCGCTCCTGCAGCCCGCGGCCCCTTATGTGCCGCCTGTGGCGCCTGTC
ATTCCCTCGATTGGTCCCTCGAGCCCGTCTGGTCCCAGCCACGGCAGCTCTGGGTCGCCCTTCTCCGGGAAGCGC
GGTCTGGCCTACAACGAAGCGGGCCTCGCCAACAAGTTCAACGGCCAGTGCAACGACTGCGCTCCGTGGGCCTAC
AACTGGGGGTCTTCGCCTCAGGGACTCTCGCCCGATACCAGCTACGTGCCCATGATGTGGGGGAACAAGCCGGCC
GCCGTCAGCAACTGGCACTCGGACGCGCAAAAGGCCCTCTCCAACGGCTGCAAGGCCATGCTCAGCATCAACGAG
CCCGACAACGCCGGCCAGGCCAACATGAGCCCGCAGGATGCGGCCGAGTTCCACGTGCGATACATGAACCCCTAC
GGCGGCAAGGCACTCATCGGCTCGCCGGCCGTGACCAACAGCGGCCAGGGCGGCCAGGGCATCGAGTGGCTCAGC
GCCTTCATCAAGGCTTGCGATGCCCTGCCGGACAAGTGCGTCGTCGACTTTTGCGTCGTCCACTGGTACTCGCCG
CCCGAGTACTCGGACACGCTGTTCGATCACATCAAAAAGGCCCACGATGTGTGCGGCGGGAAGCCCGTCTGGCTG
ACCGAGTTCGGCCCCGTCGACGCCGGCGGTCAGCCCATGAACTCGCCCGACTTCTTCAAGTCGGTGGTGCCCAAG
CTCGACGCCATCGAATACCTGCACGCCTACGCGCCTTTCATGTGCTCGAGCGGCAAGCTCATGTCGTCGCCCAAC
GAGATCAGCCTCATGGGAAAGGCCTACGCTGGTATCCCTCTTCTGTAG
Transcript >Ophun1|7415
ATGTTCACCAGCAAGATGATCGTCCTCGCCGCCCTCGCCTCTCTGGCTGGGCAGGCCGTCGCCTTCAACTCCCAC
CGCCATCTTCATCGCCGCATGGTTGGCGGGCACAAGGCCGGCGCCACTCACTGGGTCACCGTCTATGAGACTCAG
TACACGACCGTCTACGATCAAGAGCCCACCGGAGCCTCCAAGCCGGAAGCCAACGCCGTTTACGCCCCCGAACCC
GCCAAGCCGACCCCAAAGCCGGCCGAGAAGCCGGTGCACTACAAGTCGGAGGCTCCCGCCAAGCCGCCCGCTCCC
GCCTACAAGCCCGCTCCCCCTCCGGCTCCACAGGCTCCGGCCCCTGCTCGCCCTGCCCCTGCTCGCCCTGCTCCG
GCTCCCCCTGCCCCGGTCGAGCCCAAGGCTCCGGCCGTGGGGCCTTCTCGGTCTGAGGAACCGCCCAAGACGACG
CTCGAGGTTCTGCCCAAGCCAGTTGCTTCGCTCCTGCAGCCCGCGGCCCCTTATGTGCCGCCTGTGGCGCCTGTC
ATTCCCTCGATTGGTCCCTCGAGCCCGTCTGGTCCCAGCCACGGCAGCTCTGGGTCGCCCTTCTCCGGGAAGCGC
GGTCTGGCCTACAACGAAGCGGGCCTCGCCAACAAGTTCAACGGCCAGTGCAACGACTGCGCTCCGTGGGCCTAC
AACTGGGGGTCTTCGCCTCAGGGACTCTCGCCCGATACCAGCTACGTGCCCATGATGTGGGGGAACAAGCCGGCC
GCCGTCAGCAACTGGCACTCGGACGCGCAAAAGGCCCTCTCCAACGGCTGCAAGGCCATGCTCAGCATCAACGAG
CCCGACAACGCCGGCCAGGCCAACATGAGCCCGCAGGATGCGGCCGAGTTCCACGTGCGATACATGAACCCCTAC
GGCGGCAAGGCACTCATCGGCTCGCCGGCCGTGACCAACAGCGGCCAGGGCGGCCAGGGCATCGAGTGGCTCAGC
GCCTTCATCAAGGCTTGCGATGCCCTGCCGGACAAGTGCGTCGTCGACTTTTGCGTCGTCCACTGGTACTCGCCG
CCCGAGTACTCGGACACGCTGTTCGATCACATCAAAAAGGCCCACGATGTGTGCGGCGGGAAGCCCGTCTGGCTG
ACCGAGTTCGGCCCCGTCGACGCCGGCGGTCAGCCCATGAACTCGCCCGACTTCTTCAAGTCGGTGGTGCCCAAG
CTCGACGCCATCGAATACCTGCACGCCTACGCGCCTTTCATGTGCTCGAGCGGCAAGCTCATGTCGTCGCCCAAC
GAGATCAGCCTCATGGGAAAGGCCTACGCTGGTATCCCTCTTCTGTAG
Gene >Ophun1|7415
ATGTTCACCAGCAAGATGATCGTCCTCGCCGCCCTCGCCTCTCTGGCTGGGCAGGCCGTCGCCTTCAACTCCCAC
CGCCATCTTCATCGCCGCATGGTTGGCGGGCACAAGGCCGGCGCCACTCACTGGGTCACCGTCTATGAGACTCAG
TACACGACCGTCTACGATCAAGAGCCCACCGGAGCCTCCAAGCCGGAAGCCAACGCCGTTTACGCCCCCGAACCC
GCCAAGCCGACCCCAAAGCCGGCCGAGAAGCCGGTGCACTACAAGTCGGAGGCTCCCGCCAAGCCGCCCGCTCCC
GCCTACAAGCCCGCTCCCCCTCCGGCTCCACAGGCTCCGGCCCCTGCTCGCCCTGCCCCTGCTCGCCCTGCTCCG
GCTCCCCCTGCCCCGGTCGAGCCCAAGGCTCCGGCCGTGGGGCCTTCTCGGTCTGAGGAACCGCCCAAGACGACG
CTCGAGGTTCTGCCCAAGCCAGTTGCTTCGCTCCTGCAGCCCGCGGCCCCTTATGTGCCGCCTGTGGCGCCTGTC
ATTCCCTCGATTGGTCCCTCGAGCCCGTCTGGTCCCAGCCACGGCAGCTCTGGGTCGCCCTTCTCCGGGAAGCGC
GGTCTGGCCTACAACGAAGCGGGCCTCGCCAACAAGTTCAACGGCCAGTGCAACGACTGCGCTCCGTGGGCCTAC
AACTGGGGGTCTTCGCCTCAGGGACTCTCGCCCGATACCAGCTACGTGCCCATGATGTGGGGGAACAAGCCGGCC
GCCGTCAGCAACTGGCACTCGGACGCGCAAAAGGCCCTCTCCAACGGCTGCAAGGCCATGCTCAGCATCAACGAG
CCCGACAACGCCGGCCAGGCCAACATGAGCCCGCAGGATGCGGCCGAGTTCCACGTGCGATACATGAACCCCTAC
GGCGGCAAGGCACTCATCGGCTCGCCGGCCGTGACCAACAGCGGCCAGGGCGGCCAGGGCATCGAGTGGCTCAGC
GCCTTCATCAAGGCTTGCGATGCCCTGCCGGACAAGTGCGTCGTCGACTTTTGCGTCGTCCACTGGTACTCGCCG
CCCGAGTACTCGGACACGCTGTTCGATCACATCAAAAAGGCCCACGATGTGTGCGGCGGGAAGCCCGTCTGGCTG
ACCGAGTTCGGCCCCGTCGACGCCGGCGGTCAGCCCATGAACTCGCCCGACTTCTTCAAGTCGGTGGTGCCCAAG
CTCGACGCCATCGAATACCTGCACGCCTACGCGCCTTTCATGTGCTCGAGCGGCAAGCTCATGTCGTCGCCCAAC
GAGATCAGCCTCATGGGAAAGGCCTACGCTGGTATCCCTCTTCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail