Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7411
Gene name
LocationContig_927:576..2529
Strand-
Gene length (bp)1953
Transcript length (bp)1953
Coding sequence length (bp)1953
Protein length (aa) 651

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00929 RNase_T Exonuclease 8.0E-09 270 418

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94443|YFE9_SCHPO Uncharacterized exonuclease C637.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC637.09 PE=3 SV=2 36 650 6.0E-101
sp|Q8L7M4|SDN5_ARATH Small RNA degrading nuclease 5 OS=Arabidopsis thaliana GN=SDN5 PE=2 SV=2 58 650 4.0E-60
sp|P53331|REXO1_YEAST RNA exonuclease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RNH70 PE=1 SV=1 50 650 6.0E-59
sp|Q2T9U5|REXON_BOVIN Putative RNA exonuclease NEF-sp OS=Bos taurus PE=2 SV=1 47 440 1.0E-43
sp|Q96IC2|REXON_HUMAN Putative RNA exonuclease NEF-sp OS=Homo sapiens GN=44M2.3 PE=2 SV=1 60 428 1.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94443|YFE9_SCHPO Uncharacterized exonuclease C637.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC637.09 PE=3 SV=2 36 650 6.0E-101
sp|Q8L7M4|SDN5_ARATH Small RNA degrading nuclease 5 OS=Arabidopsis thaliana GN=SDN5 PE=2 SV=2 58 650 4.0E-60
sp|P53331|REXO1_YEAST RNA exonuclease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RNH70 PE=1 SV=1 50 650 6.0E-59
sp|Q2T9U5|REXON_BOVIN Putative RNA exonuclease NEF-sp OS=Bos taurus PE=2 SV=1 47 440 1.0E-43
sp|Q96IC2|REXON_HUMAN Putative RNA exonuclease NEF-sp OS=Homo sapiens GN=44M2.3 PE=2 SV=1 60 428 1.0E-40
sp|Q4R9F7|REXON_MACFA Putative RNA exonuclease NEF-sp OS=Macaca fascicularis GN=QtsA-10054 PE=2 SV=1 60 428 8.0E-40
sp|A1A5R7|REXON_RAT Putative RNA exonuclease NEF-sp OS=Rattus norvegicus PE=2 SV=1 259 428 1.0E-38
sp|Q8IX06|GOR_HUMAN Putative exonuclease GOR OS=Homo sapiens GN=REXO1L1P PE=5 SV=2 268 422 3.0E-38
sp|P48778|GOR_PANTR Exonuclease GOR OS=Pan troglodytes GN=REXO1L1 PE=2 SV=3 268 422 3.0E-37
sp|Q7TT28|REXO1_MOUSE RNA exonuclease 1 homolog OS=Mus musculus GN=Rexo1 PE=1 SV=1 268 419 7.0E-35
sp|Q8N1G1|REXO1_HUMAN RNA exonuclease 1 homolog OS=Homo sapiens GN=REXO1 PE=1 SV=3 268 419 1.0E-31
sp|Q10124|PQE1_CAEEL Putative RNA exonuclease pqe-1 OS=Caenorhabditis elegans GN=pqe-1 PE=3 SV=2 267 419 2.0E-27
sp|Q9FFG1|SDN2_ARATH Small RNA degrading nuclease 2 OS=Arabidopsis thaliana GN=SDN2 PE=2 SV=1 267 435 1.0E-26
sp|Q6CFE7|REXO3_YARLI RNA exonuclease 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=REX3 PE=3 SV=1 268 420 2.0E-26
sp|Q8RXK2|SDN3_ARATH Small RNA degrading nuclease 3 OS=Arabidopsis thaliana GN=SDN3 PE=1 SV=1 248 426 5.0E-26
sp|A3KPE8|SDN1_ARATH Small RNA degrading nuclease 1 OS=Arabidopsis thaliana GN=SDN1 PE=2 SV=1 164 418 6.0E-25
sp|Q4WYA1|REXO3_ASPFU RNA exonuclease 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rex3 PE=3 SV=1 269 436 2.0E-24
sp|Q5AL29|REXO3_CANAL RNA exonuclease 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=REX3 PE=3 SV=1 259 420 3.0E-24
sp|Q750A5|REXO3_ASHGO RNA exonuclease 3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=REX3 PE=3 SV=1 268 432 4.0E-24
sp|Q5B367|REXO3_EMENI RNA exonuclease 3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rex3 PE=3 SV=2 269 436 4.0E-23
sp|Q6CJB5|REXO3_KLULA RNA exonuclease 3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=REX3 PE=3 SV=1 268 422 5.0E-23
sp|Q9P7H2|REXO3_SCHPO RNA exonuclease 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rex3 PE=3 SV=1 270 422 7.0E-23
sp|Q9H9L3|I20L2_HUMAN Interferon-stimulated 20 kDa exonuclease-like 2 OS=Homo sapiens GN=ISG20L2 PE=1 SV=1 254 420 3.0E-22
sp|Q4WHF8|REXO4_ASPFU RNA exonuclease 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rex4 PE=3 SV=1 232 424 4.0E-22
sp|B2GUW6|AEN_RAT Apoptosis-enhancing nuclease OS=Rattus norvegicus GN=Aen PE=2 SV=1 267 420 1.0E-21
sp|Q5REE2|AEN_PONAB Apoptosis-enhancing nuclease OS=Pongo abelii GN=AEN PE=2 SV=1 267 420 2.0E-21
sp|Q9CZI9|AEN_MOUSE Apoptosis-enhancing nuclease OS=Mus musculus GN=Aen PE=2 SV=1 267 420 4.0E-21
sp|Q08237|REXO4_YEAST RNA exonuclease 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=REX4 PE=1 SV=1 267 421 5.0E-21
sp|Q6AXU3|I20L2_RAT Interferon-stimulated 20 kDa exonuclease-like 2 OS=Rattus norvegicus GN=Isg20l2 PE=2 SV=1 266 420 6.0E-21
sp|Q2YDK1|I20L2_BOVIN Interferon-stimulated 20 kDa exonuclease-like 2 OS=Bos taurus GN=ISG20L2 PE=2 SV=1 267 420 1.0E-20
sp|Q6FIU7|REXO3_CANGA RNA exonuclease 3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=REX3 PE=3 SV=1 268 422 2.0E-20
sp|Q8WTP8|AEN_HUMAN Apoptosis-enhancing nuclease OS=Homo sapiens GN=AEN PE=1 SV=2 267 420 3.0E-20
sp|Q12090|REXO3_YEAST RNA exonuclease 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=REX3 PE=1 SV=1 268 429 1.0E-19
sp|Q9SN09|SDN4_ARATH Putative small RNA degrading nuclease 4 OS=Arabidopsis thaliana GN=SDN4 PE=3 SV=1 249 406 1.0E-19
sp|Q6CMT3|REXO4_KLULA RNA exonuclease 4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=REX4 PE=3 SV=1 267 420 2.0E-19
sp|Q4PER6|REXO4_USTMA RNA exonuclease 4 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=REX4 PE=3 SV=1 269 452 4.0E-19
sp|Q3U1G5|I20L2_MOUSE Interferon-stimulated 20 kDa exonuclease-like 2 OS=Mus musculus GN=Isg20l2 PE=1 SV=2 267 420 5.0E-19
sp|O94375|REXO4_SCHPO RNA exonuclease 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rex4 PE=3 SV=1 227 421 1.0E-18
sp|Q4IEV5|REXO4_GIBZE RNA exonuclease 4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=REX4 PE=3 SV=1 267 421 4.0E-18
sp|Q6FQA0|REXO4_CANGA RNA exonuclease 4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=REX4 PE=3 SV=1 267 420 9.0E-18
sp|Q6BIK6|REXO4_DEBHA RNA exonuclease 4 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=REX4 PE=3 SV=2 267 420 2.0E-17
sp|Q757I9|REXO4_ASHGO RNA exonuclease 4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=REX4 PE=3 SV=1 258 420 2.0E-17
sp|Q9GZR2|REXO4_HUMAN RNA exonuclease 4 OS=Homo sapiens GN=REXO4 PE=1 SV=2 267 418 3.0E-17
sp|P0CQ45|REXO4_CRYNB RNA exonuclease 4 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=REX4 PE=3 SV=1 267 420 4.0E-17
sp|P0CQ44|REXO4_CRYNJ RNA exonuclease 4 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=REX4 PE=3 SV=1 267 420 4.0E-17
sp|Q6PAQ4|REXO4_MOUSE RNA exonuclease 4 OS=Mus musculus GN=Rexo4 PE=2 SV=2 267 418 2.0E-16
sp|Q96AZ6|ISG20_HUMAN Interferon-stimulated gene 20 kDa protein OS=Homo sapiens GN=ISG20 PE=1 SV=2 262 432 3.0E-16
sp|Q66UW5|ISG20_PIG Interferon-stimulated gene 20 kDa protein OS=Sus scrofa GN=Isg20 PE=1 SV=2 262 432 1.0E-15
sp|A1CEK7|PAN2_ASPCL PAB-dependent poly(A)-specific ribonuclease subunit pan2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=pan2 PE=3 SV=1 281 447 4.0E-15
sp|Q7S9B7|REXO4_NEUCR RNA exonuclease 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rex-4 PE=3 SV=1 267 422 1.0E-14
sp|Q6DEW6|REXO4_XENTR RNA exonuclease 4 OS=Xenopus tropicalis GN=rexo4 PE=2 SV=1 238 423 1.0E-14
sp|A1DFN6|PAN2_NEOFI PAB-dependent poly(A)-specific ribonuclease subunit pan2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pan2 PE=3 SV=1 285 447 2.0E-14
sp|Q5A3Q0|REXO4_CANAL RNA exonuclease 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=REX4 PE=3 SV=1 267 420 2.0E-14
sp|Q0CJU7|PAN2_ASPTN PAB-dependent poly(A)-specific ribonuclease subunit pan2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pan2 PE=3 SV=1 285 497 2.0E-14
sp|Q4WHP6|PAN2_ASPFU PAB-dependent poly(A)-specific ribonuclease subunit pan2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pan2 PE=3 SV=1 285 447 2.0E-14
sp|Q6CE69|REXO4_YARLI RNA exonuclease 4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=REX4 PE=3 SV=1 267 420 2.0E-14
sp|Q91560|REXO4_XENLA RNA exonuclease 4 OS=Xenopus laevis GN=rexo4 PE=2 SV=2 238 418 3.0E-14
sp|Q5BBL5|PAN2_EMENI PAB-dependent poly(A)-specific ribonuclease subunit pan2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pan2 PE=3 SV=1 285 447 2.0E-13
sp|Q2ULU6|PAN2_ASPOR PAB-dependent poly(A)-specific ribonuclease subunit pan2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pan2 PE=3 SV=1 285 458 9.0E-13
sp|A2QW83|PAN2_ASPNC PAB-dependent poly(A)-specific ribonuclease subunit pan2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pan2 PE=3 SV=1 285 447 5.0E-12
sp|Q5F450|PAN2_CHICK PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Gallus gallus GN=PAN2 PE=2 SV=1 298 446 1.0E-11
sp|P0CQ09|PAN2_CRYNB PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAN2 PE=3 SV=1 281 420 2.0E-11
sp|P0CQ08|PAN2_CRYNJ PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAN2 PE=3 SV=1 281 420 2.0E-11
sp|A4RF51|PAN2_MAGO7 PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAN2 PE=3 SV=3 253 414 8.0E-11
sp|Q504Q3|PAN2_HUMAN PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Homo sapiens GN=PAN2 PE=1 SV=3 298 424 1.0E-10
sp|Q6IE70|PAN2_RAT PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Rattus norvegicus GN=Pan2 PE=2 SV=1 295 424 1.0E-10
sp|Q8BGF7|PAN2_MOUSE PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Mus musculus GN=Pan2 PE=1 SV=1 298 424 1.0E-10
sp|Q2GSV2|PAN2_CHAGB PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAN2 PE=3 SV=2 284 424 1.0E-10
sp|P0C581|PAN2_NEUCR PAB-dependent poly(A)-specific ribonuclease subunit pan2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pan2 PE=1 SV=2 268 424 5.0E-10
sp|Q1E873|PAN2_COCIM PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Coccidioides immitis (strain RS) GN=PAN2 PE=3 SV=2 285 447 6.0E-10
sp|A5E1W0|PAN2_LODEL PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PAN2 PE=3 SV=1 295 428 1.0E-09
sp|P53015|YPO4_CAEEL Uncharacterized protein F31E3.4 OS=Caenorhabditis elegans GN=F31E3.4 PE=4 SV=1 284 424 3.0E-09
sp|Q0UPL5|PAN2_PHANO PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAN2 PE=3 SV=1 285 424 3.0E-09
sp|Q9JL16|ISG20_MOUSE Interferon-stimulated gene 20 kDa protein OS=Mus musculus GN=Isg20 PE=1 SV=1 267 399 3.0E-09
sp|A3LRV8|PAN2_PICST PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PAN2 PE=3 SV=2 295 424 5.0E-09
sp|Q54U94|REXO4_DICDI RNA exonuclease 4 OS=Dictyostelium discoideum GN=rexo4 PE=3 SV=1 247 356 1.0E-08
sp|P53010|PAN2_YEAST PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAN2 PE=1 SV=1 284 421 2.0E-08
sp|A5DAD0|PAN2_PICGU PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PAN2 PE=3 SV=3 282 424 4.0E-08
sp|Q6CMN5|PAN2_KLULA PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PAN2 PE=3 SV=1 284 440 5.0E-08
sp|Q6BZ78|PAN2_DEBHA PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PAN2 PE=3 SV=2 284 414 2.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2193
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7904
Ophiocordyceps australis map64 (Brazil) OphauB2|5446
Ophiocordyceps camponoti-floridani Ophcf2|04636
Ophiocordyceps camponoti-rufipedis Ophun1|7411 (this protein)
Ophiocordyceps kimflemingae Ophio5|6718
Ophiocordyceps subramaniannii Hirsu2|2732

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7411
MSDGSLKRTNPHDEDDEAGGEWQVVTRPKKKPKKVPKSGRNYPAFTISSKSRLSSKPNLNQLRDLILYILADGPA
PQWIVVSHRPQFRKLVVIMIPGLEEAMFEEGVDLSTFADAGNDKSVTDLDDCRPRPLIKDKLDPALQPLADMFTE
MWPMRTPGDDKHARMHSPITSMLTAPAPKEKASKQVHLGLEPQGWQNERTRITEFLAAAEELEDNNFTLHPALLP
AGERRDAFVAPKGWVTTKVQSLDDGDVPEAEIESGSVTAGRKVLALDCEMCMTGENEFALTRISIVDWAGDVVMD
ELVKPDKPIVDYVTRFSGITEEMLAPVTTTLADIQKRLLDLIDARTILVGHSLESDTKALRLAHPFIVDTSILYP
HPRGSPLKSSLKYLAQRFLSREIQKGGADGHNSIEDARTCLDLVKQKCERGPKWGIPDNKGENLFRRLARAGTTY
KVQGGDSARGGVETGKTSAAVDWGDPSRGAGAGATFQLGCRNDDDVTDAILRAVHGDADGKEIRAGGVDFIWARM
RELEVQLGWCNDGTTTTTTTTTAASNTSNQTPPPLQNTLTALTTRLTRIHASLPPCTGLILLSGSGDPRAMSRLQ
RQHARHRKEVNAQGPDDEGEVPVKWTDEEQEALKRAVQVARSGIAFLGVK*
Coding >Ophun1|7411
ATGAGCGACGGAAGCCTCAAGCGAACCAACCCTCATGATGAGGACGACGAGGCCGGCGGCGAGTGGCAGGTCGTC
ACGCGACCCAAGAAGAAGCCCAAAAAGGTTCCTAAATCGGGCAGAAACTATCCCGCCTTTACCATTTCGTCCAAG
TCTCGCCTGAGCTCGAAGCCCAATCTCAACCAACTACGCGATCTGATTCTATACATACTCGCCGATGGGCCTGCG
CCGCAGTGGATCGTCGTCTCCCACCGGCCGCAATTTCGAAAGCTCGTCGTCATCATGATCCCAGGTCTCGAGGAA
GCCATGTTCGAAGAGGGTGTCGACTTGTCCACCTTCGCTGACGCGGGTAACGACAAGTCCGTCACAGATTTGGAC
GACTGCCGTCCTCGCCCTCTCATCAAGGACAAACTCGATCCAGCTCTTCAGCCGCTGGCAGACATGTTTACCGAA
ATGTGGCCCATGAGGACACCAGGCGACGACAAGCACGCAAGGATGCATTCGCCCATCACCTCGATGCTCACGGCG
CCCGCGCCCAAGGAGAAGGCTTCGAAGCAAGTGCATCTGGGATTAGAGCCGCAGGGCTGGCAGAACGAGCGAACG
CGCATCACCGAGTTTCTCGCTGCCGCTGAGGAGCTAGAAGACAACAACTTTACGCTTCACCCTGCTCTCCTTCCC
GCGGGTGAGAGACGAGATGCCTTTGTCGCGCCCAAAGGCTGGGTGACGACCAAAGTACAGTCTCTGGACGATGGC
GACGTGCCCGAAGCCGAGATTGAGAGCGGCAGCGTCACGGCAGGCCGAAAGGTGCTGGCCCTGGACTGCGAGATG
TGCATGACTGGCGAAAACGAGTTCGCCCTGACGCGCATCAGCATCGTCGACTGGGCAGGCGACGTCGTGATGGAC
GAGCTGGTCAAGCCCGATAAGCCCATCGTCGACTACGTCACTCGCTTCTCCGGCATCACGGAGGAGATGCTGGCG
CCTGTGACGACGACACTGGCTGACATCCAGAAGCGACTGCTCGACCTCATCGACGCCCGCACCATCCTCGTCGGC
CACTCGCTCGAGTCAGACACCAAGGCTCTTCGTCTAGCCCATCCCTTCATCGTCGACACGTCGATCCTCTACCCT
CACCCCCGAGGCTCACCCCTCAAGTCATCGCTCAAGTACCTAGCACAACGATTCCTATCCCGCGAGATCCAAAAG
GGCGGCGCCGACGGCCACAACAGCATCGAAGACGCAAGAACCTGCCTCGACCTCGTCAAGCAAAAGTGCGAACGC
GGTCCCAAATGGGGCATCCCGGACAACAAGGGCGAGAACCTCTTCCGCCGCCTCGCCCGAGCGGGAACGACATAC
AAGGTCCAGGGCGGTGACTCGGCCCGCGGCGGCGTCGAGACGGGCAAGACGAGCGCTGCTGTCGACTGGGGCGAC
CCTTCTCGCGGTGCGGGAGCCGGCGCTACCTTTCAACTCGGCTGCCGCAACGACGACGACGTCACCGACGCCATC
CTCCGCGCCGTCCACGGAGATGCCGACGGAAAGGAGATTCGAGCCGGCGGCGTCGACTTCATCTGGGCACGCATG
CGCGAACTCGAAGTCCAACTGGGCTGGTGCAACGACGGAACAACAACAACAACAACAACAACAACCGCAGCATCC
AACACCTCCAACCAAACACCCCCCCCCCTCCAAAACACCCTCACCGCCCTAACAACCCGCCTCACCCGCATCCAC
GCCTCCCTGCCCCCCTGCACAGGCCTCATCCTCCTCAGCGGCTCAGGCGACCCGCGCGCCATGTCCCGCCTGCAG
CGACAGCACGCCCGCCACCGCAAGGAGGTCAACGCTCAGGGGCCCGACGACGAGGGGGAGGTGCCGGTCAAGTGG
ACGGATGAGGAGCAGGAGGCGTTGAAGAGGGCCGTGCAGGTTGCGCGTTCGGGGATTGCGTTTTTGGGCGTCAAG
TGA
Transcript >Ophun1|7411
ATGAGCGACGGAAGCCTCAAGCGAACCAACCCTCATGATGAGGACGACGAGGCCGGCGGCGAGTGGCAGGTCGTC
ACGCGACCCAAGAAGAAGCCCAAAAAGGTTCCTAAATCGGGCAGAAACTATCCCGCCTTTACCATTTCGTCCAAG
TCTCGCCTGAGCTCGAAGCCCAATCTCAACCAACTACGCGATCTGATTCTATACATACTCGCCGATGGGCCTGCG
CCGCAGTGGATCGTCGTCTCCCACCGGCCGCAATTTCGAAAGCTCGTCGTCATCATGATCCCAGGTCTCGAGGAA
GCCATGTTCGAAGAGGGTGTCGACTTGTCCACCTTCGCTGACGCGGGTAACGACAAGTCCGTCACAGATTTGGAC
GACTGCCGTCCTCGCCCTCTCATCAAGGACAAACTCGATCCAGCTCTTCAGCCGCTGGCAGACATGTTTACCGAA
ATGTGGCCCATGAGGACACCAGGCGACGACAAGCACGCAAGGATGCATTCGCCCATCACCTCGATGCTCACGGCG
CCCGCGCCCAAGGAGAAGGCTTCGAAGCAAGTGCATCTGGGATTAGAGCCGCAGGGCTGGCAGAACGAGCGAACG
CGCATCACCGAGTTTCTCGCTGCCGCTGAGGAGCTAGAAGACAACAACTTTACGCTTCACCCTGCTCTCCTTCCC
GCGGGTGAGAGACGAGATGCCTTTGTCGCGCCCAAAGGCTGGGTGACGACCAAAGTACAGTCTCTGGACGATGGC
GACGTGCCCGAAGCCGAGATTGAGAGCGGCAGCGTCACGGCAGGCCGAAAGGTGCTGGCCCTGGACTGCGAGATG
TGCATGACTGGCGAAAACGAGTTCGCCCTGACGCGCATCAGCATCGTCGACTGGGCAGGCGACGTCGTGATGGAC
GAGCTGGTCAAGCCCGATAAGCCCATCGTCGACTACGTCACTCGCTTCTCCGGCATCACGGAGGAGATGCTGGCG
CCTGTGACGACGACACTGGCTGACATCCAGAAGCGACTGCTCGACCTCATCGACGCCCGCACCATCCTCGTCGGC
CACTCGCTCGAGTCAGACACCAAGGCTCTTCGTCTAGCCCATCCCTTCATCGTCGACACGTCGATCCTCTACCCT
CACCCCCGAGGCTCACCCCTCAAGTCATCGCTCAAGTACCTAGCACAACGATTCCTATCCCGCGAGATCCAAAAG
GGCGGCGCCGACGGCCACAACAGCATCGAAGACGCAAGAACCTGCCTCGACCTCGTCAAGCAAAAGTGCGAACGC
GGTCCCAAATGGGGCATCCCGGACAACAAGGGCGAGAACCTCTTCCGCCGCCTCGCCCGAGCGGGAACGACATAC
AAGGTCCAGGGCGGTGACTCGGCCCGCGGCGGCGTCGAGACGGGCAAGACGAGCGCTGCTGTCGACTGGGGCGAC
CCTTCTCGCGGTGCGGGAGCCGGCGCTACCTTTCAACTCGGCTGCCGCAACGACGACGACGTCACCGACGCCATC
CTCCGCGCCGTCCACGGAGATGCCGACGGAAAGGAGATTCGAGCCGGCGGCGTCGACTTCATCTGGGCACGCATG
CGCGAACTCGAAGTCCAACTGGGCTGGTGCAACGACGGAACAACAACAACAACAACAACAACAACCGCAGCATCC
AACACCTCCAACCAAACACCCCCCCCCCTCCAAAACACCCTCACCGCCCTAACAACCCGCCTCACCCGCATCCAC
GCCTCCCTGCCCCCCTGCACAGGCCTCATCCTCCTCAGCGGCTCAGGCGACCCGCGCGCCATGTCCCGCCTGCAG
CGACAGCACGCCCGCCACCGCAAGGAGGTCAACGCTCAGGGGCCCGACGACGAGGGGGAGGTGCCGGTCAAGTGG
ACGGATGAGGAGCAGGAGGCGTTGAAGAGGGCCGTGCAGGTTGCGCGTTCGGGGATTGCGTTTTTGGGCGTCAAG
TGA
Gene >Ophun1|7411
ATGAGCGACGGAAGCCTCAAGCGAACCAACCCTCATGATGAGGACGACGAGGCCGGCGGCGAGTGGCAGGTCGTC
ACGCGACCCAAGAAGAAGCCCAAAAAGGTTCCTAAATCGGGCAGAAACTATCCCGCCTTTACCATTTCGTCCAAG
TCTCGCCTGAGCTCGAAGCCCAATCTCAACCAACTACGCGATCTGATTCTATACATACTCGCCGATGGGCCTGCG
CCGCAGTGGATCGTCGTCTCCCACCGGCCGCAATTTCGAAAGCTCGTCGTCATCATGATCCCAGGTCTCGAGGAA
GCCATGTTCGAAGAGGGTGTCGACTTGTCCACCTTCGCTGACGCGGGTAACGACAAGTCCGTCACAGATTTGGAC
GACTGCCGTCCTCGCCCTCTCATCAAGGACAAACTCGATCCAGCTCTTCAGCCGCTGGCAGACATGTTTACCGAA
ATGTGGCCCATGAGGACACCAGGCGACGACAAGCACGCAAGGATGCATTCGCCCATCACCTCGATGCTCACGGCG
CCCGCGCCCAAGGAGAAGGCTTCGAAGCAAGTGCATCTGGGATTAGAGCCGCAGGGCTGGCAGAACGAGCGAACG
CGCATCACCGAGTTTCTCGCTGCCGCTGAGGAGCTAGAAGACAACAACTTTACGCTTCACCCTGCTCTCCTTCCC
GCGGGTGAGAGACGAGATGCCTTTGTCGCGCCCAAAGGCTGGGTGACGACCAAAGTACAGTCTCTGGACGATGGC
GACGTGCCCGAAGCCGAGATTGAGAGCGGCAGCGTCACGGCAGGCCGAAAGGTGCTGGCCCTGGACTGCGAGATG
TGCATGACTGGCGAAAACGAGTTCGCCCTGACGCGCATCAGCATCGTCGACTGGGCAGGCGACGTCGTGATGGAC
GAGCTGGTCAAGCCCGATAAGCCCATCGTCGACTACGTCACTCGCTTCTCCGGCATCACGGAGGAGATGCTGGCG
CCTGTGACGACGACACTGGCTGACATCCAGAAGCGACTGCTCGACCTCATCGACGCCCGCACCATCCTCGTCGGC
CACTCGCTCGAGTCAGACACCAAGGCTCTTCGTCTAGCCCATCCCTTCATCGTCGACACGTCGATCCTCTACCCT
CACCCCCGAGGCTCACCCCTCAAGTCATCGCTCAAGTACCTAGCACAACGATTCCTATCCCGCGAGATCCAAAAG
GGCGGCGCCGACGGCCACAACAGCATCGAAGACGCAAGAACCTGCCTCGACCTCGTCAAGCAAAAGTGCGAACGC
GGTCCCAAATGGGGCATCCCGGACAACAAGGGCGAGAACCTCTTCCGCCGCCTCGCCCGAGCGGGAACGACATAC
AAGGTCCAGGGCGGTGACTCGGCCCGCGGCGGCGTCGAGACGGGCAAGACGAGCGCTGCTGTCGACTGGGGCGAC
CCTTCTCGCGGTGCGGGAGCCGGCGCTACCTTTCAACTCGGCTGCCGCAACGACGACGACGTCACCGACGCCATC
CTCCGCGCCGTCCACGGAGATGCCGACGGAAAGGAGATTCGAGCCGGCGGCGTCGACTTCATCTGGGCACGCATG
CGCGAACTCGAAGTCCAACTGGGCTGGTGCAACGACGGAACAACAACAACAACAACAACAACAACCGCAGCATCC
AACACCTCCAACCAAACACCCCCCCCCCTCCAAAACACCCTCACCGCCCTAACAACCCGCCTCACCCGCATCCAC
GCCTCCCTGCCCCCCTGCACAGGCCTCATCCTCCTCAGCGGCTCAGGCGACCCGCGCGCCATGTCCCGCCTGCAG
CGACAGCACGCCCGCCACCGCAAGGAGGTCAACGCTCAGGGGCCCGACGACGAGGGGGAGGTGCCGGTCAAGTGG
ACGGATGAGGAGCAGGAGGCGTTGAAGAGGGCCGTGCAGGTTGCGCGTTCGGGGATTGCGTTTTTGGGCGTCAAG
TGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail