Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7410
Gene name
LocationContig_925:3252..4997
Strand-
Gene length (bp)1745
Transcript length (bp)1647
Coding sequence length (bp)1647
Protein length (aa) 549

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 4.3E-39 76 460

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 36 509 1.0E-94
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 54 509 2.0E-88
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 56 507 1.0E-87
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 25 503 3.0E-87
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 25 505 3.0E-87
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 36 509 1.0E-94
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 54 509 2.0E-88
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 56 507 1.0E-87
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 25 503 3.0E-87
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 25 505 3.0E-87
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 8 513 7.0E-86
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 3 507 3.0E-84
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 55 509 3.0E-83
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 4 509 3.0E-82
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 14 507 2.0E-80
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 51 510 1.0E-74
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 29 506 9.0E-74
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 45 484 6.0E-71
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 56 509 8.0E-71
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 74 510 3.0E-70
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 56 508 2.0E-68
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 42 543 5.0E-64
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 56 508 5.0E-64
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 45 509 8.0E-64
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 64 507 4.0E-63
sp|P28873|BMRP_CANAX Benomyl/methotrexate resistance protein OS=Candida albicans GN=MDR1 PE=3 SV=1 56 507 8.0E-63
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 56 507 9.0E-63
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 56 501 3.0E-61
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 56 501 2.0E-60
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 55 503 7.0E-59
sp|O59833|YCUD_SCHPO Uncharacterized transporter C965.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.13 PE=3 SV=1 52 520 2.0E-41
sp|P33532|BSU1_SCHPO Vitamin B6 transporter bsu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bsu1 PE=3 SV=2 6 501 3.0E-40
sp|O74899|YQEH_SCHPO Uncharacterized transporter C576.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC576.17c PE=1 SV=1 89 509 9.0E-32
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 56 267 4.0E-25
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 18 248 1.0E-22
sp|G2TRN8|YI74_SCHPO Putative uncharacterized transporter C977.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC977.04 PE=5 SV=1 359 501 1.0E-21
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 95 474 1.0E-20
sp|P40475|QDR1_YEAST Quinidine resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR1 PE=1 SV=1 35 459 8.0E-10
sp|O34307|YVMA_BACSU Uncharacterized MFS-type transporter YvmA OS=Bacillus subtilis (strain 168) GN=yvmA PE=3 SV=1 70 247 2.0E-09
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 301 497 7.0E-09
sp|P45123|BCR_HAEIN Bicyclomycin resistance protein homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=bcr PE=3 SV=1 96 249 2.0E-08
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 241 471 8.0E-08
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 56 264 1.0E-07
sp|Q1RI77|BCRH_RICBR Uncharacterized transporter RBE_0856 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0856 PE=3 SV=1 86 252 4.0E-07
sp|P46105|ACT22_STRCO Probable actinorhodin transporter OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=actII-2 PE=3 SV=1 96 226 1.0E-06
sp|Q4UMJ9|BCRH_RICFE Uncharacterized transporter RF_0358 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0358 PE=3 SV=1 86 257 4.0E-06
sp|Q68WD6|BCRH_RICTY Uncharacterized transporter RT0591 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=RT0591 PE=3 SV=1 85 257 4.0E-06
sp|P9WG89|EMRB_MYCTU Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=emrB PE=3 SV=1 94 226 5.0E-06
sp|P9WG88|EMRB_MYCTO Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=emrB PE=3 SV=1 94 226 5.0E-06
sp|P40474|QDR2_YEAST Quinidine resistance protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR2 PE=1 SV=1 63 248 7.0E-06
sp|O88446|S22A3_RAT Solute carrier family 22 member 3 OS=Rattus norvegicus GN=Slc22a3 PE=2 SV=1 116 282 7.0E-06
sp|Q9WTW5|S22A3_MOUSE Solute carrier family 22 member 3 OS=Mus musculus GN=Slc22a3 PE=2 SV=1 116 282 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

Domain # Start End Length
1 69 91 22
2 106 125 19
3 137 156 19
4 161 183 22
5 195 217 22
6 232 254 22
7 305 327 22
8 337 359 22
9 379 398 19
10 408 430 22
11 437 459 22
12 474 496 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7410
MTIHGDIESLRRPAARASHFSVLLDPAGADEAAIAQRYPGHGTPQSPFIVDFLPVDARNPVTFSRPFKWLITWLA
AFSTLAVSFASSAYSGGTTFIRAEFAVSSEVVILGVSMFVLGFAVGPLIWAPMSELYGRQRVFFITYMALTAFNA
AAAAAPNMAALIVFRFLAGAFGSSPLTNSGGVIADMFSAGERGLATSVFSLAPFLGPALGPIASGFLGEAAGWRW
IQGFMAIFSGLLWILYSAVCPETYVPFLLSERAAALTRKTGRCYISKLDAGKPPTSVGARFATALSRPWLLLFRE
PIVLLTALYMAIIYGTLYMCFAAFPIVFQQGRGWKPGIGGLTFCGIAVGSAIALLSNLLDDRRFRKVVLRHQGAP
PPETRLPPALVGCCLIPFGLLWFAWTNGPTVHWAIPITASAFFAAGNVLVFLSLMNYIIDAYVIYAASALAANSV
IRSLFGAIFPLFTPYMYQGLGTNWASSVPAFLALACVPLPFLFYRYGAGIRVRCKYAAEAAHMLDMVRAKQTQMT
EDGATTEADEAEKTTTRDDGRMG*
Coding >Ophun1|7410
ATGACAATCCACGGCGATATAGAGTCCCTGCGTCGGCCGGCCGCCAGGGCCTCTCACTTTTCCGTCCTCTTGGAC
CCAGCCGGCGCCGATGAAGCGGCCATTGCCCAACGATATCCCGGTCATGGCACGCCACAGTCGCCCTTTATCGTC
GACTTTCTTCCCGTCGATGCCAGGAATCCCGTCACCTTTTCCAGGCCTTTCAAGTGGCTCATCACCTGGCTCGCT
GCCTTTTCGACGCTGGCCGTCTCCTTCGCCAGCTCGGCGTACTCGGGCGGCACCACCTTCATTAGGGCCGAGTTC
GCCGTCTCGTCCGAGGTCGTCATTCTCGGCGTTTCAATGTTCGTCTTGGGCTTCGCTGTTGGGCCTCTCATCTGG
GCGCCCATGTCGGAGCTCTATGGCCGTCAGCGCGTCTTCTTCATCACCTACATGGCCCTGACGGCCTTCAACGCC
GCCGCCGCCGCCGCTCCCAACATGGCGGCCCTCATCGTCTTCCGCTTCCTCGCAGGAGCCTTTGGCTCATCGCCG
TTGACCAACTCGGGAGGCGTCATTGCCGACATGTTCTCCGCCGGGGAGCGCGGCCTCGCCACCTCCGTCTTTTCC
CTTGCACCTTTTCTTGGTCCCGCCCTAGGCCCCATTGCCAGTGGCTTCCTCGGCGAGGCCGCCGGTTGGCGTTGG
ATCCAGGGCTTCATGGCCATCTTCTCCGGGCTCCTGTGGATCCTCTACTCGGCCGTCTGCCCTGAGACGTATGTG
CCTTTTCTGCTCAGCGAGCGTGCCGCCGCCCTCACGCGCAAGACGGGTCGCTGCTACATATCCAAACTCGACGCC
GGCAAGCCCCCCACGAGTGTCGGCGCCCGCTTCGCAACCGCCCTCTCCCGCCCCTGGCTCCTCCTTTTCCGCGAG
CCCATCGTCTTGCTGACGGCGCTGTACATGGCTATTATCTATGGCACCCTGTACATGTGCTTTGCCGCCTTCCCC
ATCGTCTTCCAGCAAGGCAGGGGGTGGAAGCCCGGCATTGGCGGCTTGACGTTTTGCGGCATCGCCGTCGGCAGC
GCCATCGCCCTTCTCAGCAACCTGCTGGACGACAGGCGATTCCGCAAAGTGGTGCTGCGTCATCAGGGAGCTCCG
CCGCCCGAGACGAGACTGCCCCCGGCCCTGGTCGGTTGCTGCCTCATACCCTTTGGACTCCTCTGGTTCGCCTGG
ACGAATGGTCCCACGGTACACTGGGCGATCCCCATCACTGCCTCGGCCTTTTTCGCCGCCGGCAACGTCCTGGTC
TTCTTATCCCTGATGAATTACATCATTGATGCCTATGTCATTTATGCGGCCTCGGCACTCGCGGCCAACTCGGTT
ATTCGATCGCTGTTTGGGGCCATCTTTCCGCTCTTCACCCCCTACATGTACCAGGGCCTCGGTACCAATTGGGCG
AGCTCGGTCCCGGCGTTCCTGGCGCTCGCCTGCGTGCCGCTCCCCTTCCTGTTCTACCGATACGGCGCCGGGATC
CGCGTCAGGTGCAAGTATGCGGCCGAAGCTGCCCACATGCTCGACATGGTGCGCGCCAAGCAGACGCAGATGACG
GAAGACGGGGCGACGACGGAAGCGGACGAGGCCGAGAAGACGACGACACGGGACGACGGGAGGATGGGATGA
Transcript >Ophun1|7410
ATGACAATCCACGGCGATATAGAGTCCCTGCGTCGGCCGGCCGCCAGGGCCTCTCACTTTTCCGTCCTCTTGGAC
CCAGCCGGCGCCGATGAAGCGGCCATTGCCCAACGATATCCCGGTCATGGCACGCCACAGTCGCCCTTTATCGTC
GACTTTCTTCCCGTCGATGCCAGGAATCCCGTCACCTTTTCCAGGCCTTTCAAGTGGCTCATCACCTGGCTCGCT
GCCTTTTCGACGCTGGCCGTCTCCTTCGCCAGCTCGGCGTACTCGGGCGGCACCACCTTCATTAGGGCCGAGTTC
GCCGTCTCGTCCGAGGTCGTCATTCTCGGCGTTTCAATGTTCGTCTTGGGCTTCGCTGTTGGGCCTCTCATCTGG
GCGCCCATGTCGGAGCTCTATGGCCGTCAGCGCGTCTTCTTCATCACCTACATGGCCCTGACGGCCTTCAACGCC
GCCGCCGCCGCCGCTCCCAACATGGCGGCCCTCATCGTCTTCCGCTTCCTCGCAGGAGCCTTTGGCTCATCGCCG
TTGACCAACTCGGGAGGCGTCATTGCCGACATGTTCTCCGCCGGGGAGCGCGGCCTCGCCACCTCCGTCTTTTCC
CTTGCACCTTTTCTTGGTCCCGCCCTAGGCCCCATTGCCAGTGGCTTCCTCGGCGAGGCCGCCGGTTGGCGTTGG
ATCCAGGGCTTCATGGCCATCTTCTCCGGGCTCCTGTGGATCCTCTACTCGGCCGTCTGCCCTGAGACGTATGTG
CCTTTTCTGCTCAGCGAGCGTGCCGCCGCCCTCACGCGCAAGACGGGTCGCTGCTACATATCCAAACTCGACGCC
GGCAAGCCCCCCACGAGTGTCGGCGCCCGCTTCGCAACCGCCCTCTCCCGCCCCTGGCTCCTCCTTTTCCGCGAG
CCCATCGTCTTGCTGACGGCGCTGTACATGGCTATTATCTATGGCACCCTGTACATGTGCTTTGCCGCCTTCCCC
ATCGTCTTCCAGCAAGGCAGGGGGTGGAAGCCCGGCATTGGCGGCTTGACGTTTTGCGGCATCGCCGTCGGCAGC
GCCATCGCCCTTCTCAGCAACCTGCTGGACGACAGGCGATTCCGCAAAGTGGTGCTGCGTCATCAGGGAGCTCCG
CCGCCCGAGACGAGACTGCCCCCGGCCCTGGTCGGTTGCTGCCTCATACCCTTTGGACTCCTCTGGTTCGCCTGG
ACGAATGGTCCCACGGTACACTGGGCGATCCCCATCACTGCCTCGGCCTTTTTCGCCGCCGGCAACGTCCTGGTC
TTCTTATCCCTGATGAATTACATCATTGATGCCTATGTCATTTATGCGGCCTCGGCACTCGCGGCCAACTCGGTT
ATTCGATCGCTGTTTGGGGCCATCTTTCCGCTCTTCACCCCCTACATGTACCAGGGCCTCGGTACCAATTGGGCG
AGCTCGGTCCCGGCGTTCCTGGCGCTCGCCTGCGTGCCGCTCCCCTTCCTGTTCTACCGATACGGCGCCGGGATC
CGCGTCAGGTGCAAGTATGCGGCCGAAGCTGCCCACATGCTCGACATGGTGCGCGCCAAGCAGACGCAGATGACG
GAAGACGGGGCGACGACGGAAGCGGACGAGGCCGAGAAGACGACGACACGGGACGACGGGAGGATGGGATGA
Gene >Ophun1|7410
ATGACAATCCACGGCGATATAGAGTCCCTGCGTCGGCCGGCCGCCAGGGCCTCTCACTTTTCCGTCCTCTTGGAC
CCAGCCGGCGCCGATGAAGCGGCCATTGCCCAACGATATCCCGGTCATGGCACGCCACAGTCGCCCTTTATCGTC
GACTTTCTTCCCGTCGATGCCAGGAATCCCGTCACCTTTTCCAGGCCTTTCAAGTGGCTCATCACCTGGCTCGCT
GCCTTTTCGACGCTGGCCGTCTCCTTCGCCAGCTCGGCGTACTCGGGCGGCACCACCTTCATTAGGGCCGAGTTC
GCCGTCTCGTCCGAGGTCGTCATTCTCGGCGTTTCAATGTTCGTCTTGGGCTTCGCTGTTGGGCCTCTCATCTGG
GCGCCCATGTCGGAGCTCTATGGCCGTCAGCGCGTCTTCTTCATCACCTACATGGCCCTGACGGCCTTCAACGCC
GCCGCCGCCGCCGCTCCCAACATGGCGGCCCTCATCGTCTTCCGCTTCCTCGCAGGAGCCTTTGGCTCATCGCCG
TTGACCAACTCGGGAGGCGTCATTGCCGACATGTTCTCCGCCGGGGAGCGCGGCCTCGCCACCTCCGTCTTTTCC
CTTGCACCTTTTCTTGGTCCCGCCCTAGGTAAGGCCCTCTCTAGCCATCTCCGGCTGCCGCTGACGCTGCATCAT
AGGCCCCATTGCCAGTGGCTTCCTCGGCGAGGCCGCCGGTTGGCGTTGGATCCAGGGCTTCATGGCCATCTTCTC
CGGGCTCCTGTGGATCCTCTACTCGGCCGTCTGCCCTGAGACGTATGTGCCTTTTCTGCTCAGCGAGCGTGCCGC
CGCCCTCACGCGCAAGACGGGTCGCTGCTACATATCCAAACTCGACGCCGGCAAGCCCCCCACGAGTGTCGGCGC
CCGCTTCGCAACCGCCCTCTCCCGCCCCTGGCTCCTCCTTTTCCGCGAGCCCATCGTCTTGCTGACGGCGCTGTA
CATGGCTATTATCTATGGCACCCTGTACATGTGCTTTGCCGCCTTCCCCATCGTCTTCCAGCAAGGCAGGGGGTG
GAAGCCCGGCATTGGCGGCTTGACGTTTTGCGGCATCGCCGTCGGCAGCGCCATCGCCCTTCTCAGCAACCTGCT
GGACGACAGGCGATTCCGCAAAGTGGTGCTGCGTCATCAGGGAGCTCCGCCGCCCGAGACGAGACTGCCCCCGGC
CCTGGTCGGTTGCTGCCTCATACCCTTTGGACTCCTCTGGTTCGCCTGGACGAATGGTCCCACGGTACACTGGGC
GATCCCCATCACTGCCTCGGCCTTTTTCGCCGCCGGCAACGTCCTGGTCTTCTTATCCCTGATGAATTACATCAT
TGATGCCTGTGCGTGTGCTTTGCCCCCTGAGTGACTGAGAGGTGCTGACGGGATCAGATGTCATTTATGCGGCCT
CGGCACTCGCGGCCAACTCGGTTATTCGATCGCTGTTTGGGGCCATCTTTCCGCTCTTCACCCCCTACATGTACC
AGGGCCTCGGTACCAATTGGGCGAGCTCGGTCCCGGCGTTCCTGGCGCTCGCCTGCGTGCCGCTCCCCTTCCTGT
TCTACCGATACGGCGCCGGGATCCGCGTCAGGTGCAAGTATGCGGCCGAAGCTGCCCACATGCTCGACATGGTGC
GCGCCAAGCAGACGCAGATGACGGAAGACGGGGCGACGACGGAAGCGGACGAGGCCGAGAAGACGACGACACGGG
ACGACGGGAGGATGGGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail