Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|741
Gene name
LocationContig_125:1429..2395
Strand+
Gene length (bp)966
Transcript length (bp)966
Coding sequence length (bp)966
Protein length (aa) 322

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17903 KH_8 Krr1 KH1 domain 2.2E-28 38 117

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|E7LRT8|KRR1_YEASV KRR1 small subunit processome component OS=Saccharomyces cerevisiae (strain VIN 13) GN=KRR1 PE=3 SV=1 27 308 3.0E-129
sp|P25586|KRR1_YEAST KRR1 small subunit processome component OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KRR1 PE=1 SV=1 27 308 3.0E-129
sp|C8Z430|KRR1_YEAS8 KRR1 small subunit processome component OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=KRR1 PE=3 SV=1 27 308 3.0E-129
sp|B5VEQ2|KRR1_YEAS6 KRR1 small subunit processome component OS=Saccharomyces cerevisiae (strain AWRI1631) GN=KRR1 PE=3 SV=1 27 308 3.0E-129
sp|B3LU25|KRR1_YEAS1 KRR1 small subunit processome component OS=Saccharomyces cerevisiae (strain RM11-1a) GN=KRR1 PE=3 SV=1 27 308 3.0E-129
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|E7LRT8|KRR1_YEASV KRR1 small subunit processome component OS=Saccharomyces cerevisiae (strain VIN 13) GN=KRR1 PE=3 SV=1 27 308 3.0E-129
sp|P25586|KRR1_YEAST KRR1 small subunit processome component OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KRR1 PE=1 SV=1 27 308 3.0E-129
sp|C8Z430|KRR1_YEAS8 KRR1 small subunit processome component OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=KRR1 PE=3 SV=1 27 308 3.0E-129
sp|B5VEQ2|KRR1_YEAS6 KRR1 small subunit processome component OS=Saccharomyces cerevisiae (strain AWRI1631) GN=KRR1 PE=3 SV=1 27 308 3.0E-129
sp|B3LU25|KRR1_YEAS1 KRR1 small subunit processome component OS=Saccharomyces cerevisiae (strain RM11-1a) GN=KRR1 PE=3 SV=1 27 308 3.0E-129
sp|E7QBZ1|KRR1_YEASZ KRR1 small subunit processome component OS=Saccharomyces cerevisiae (strain Zymaflore VL3) GN=KRR1 PE=3 SV=1 27 308 3.0E-129
sp|O74777|KRR1_SCHPO KRR1 small subunit processome component homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mis3 PE=3 SV=1 33 315 4.0E-125
sp|B4JDU5|KRR1_DROGR KRR1 small subunit processome component homolog OS=Drosophila grimshawi GN=dbe PE=3 SV=1 33 321 5.0E-117
sp|Q8BGA5|KRR1_MOUSE KRR1 small subunit processome component homolog OS=Mus musculus GN=Krr1 PE=2 SV=1 33 320 1.0E-114
sp|Q3B7L9|KRR1_BOVIN KRR1 small subunit processome component homolog OS=Bos taurus GN=KRR1 PE=2 SV=2 33 308 2.0E-114
sp|B4N0P7|KRR1_DROWI KRR1 small subunit processome component homolog OS=Drosophila willistoni GN=dbe PE=3 SV=1 33 320 4.0E-114
sp|Q13601|KRR1_HUMAN KRR1 small subunit processome component homolog OS=Homo sapiens GN=KRR1 PE=1 SV=4 33 321 5.0E-114
sp|Q9VPU8|KRR1_DROME KRR1 small subunit processome component homolog OS=Drosophila melanogaster GN=dbe PE=1 SV=1 33 317 9.0E-113
sp|B4P2Y8|KRR1_DROYA KRR1 small subunit processome component homolog OS=Drosophila yakuba GN=dbe PE=3 SV=1 33 317 3.0E-112
sp|B3N899|KRR1_DROER KRR1 small subunit processome component homolog OS=Drosophila erecta GN=dbe PE=3 SV=1 10 308 4.0E-112
sp|B4KF66|KRR1_DROMO KRR1 small subunit processome component homolog OS=Drosophila mojavensis GN=dbe PE=3 SV=1 33 316 1.0E-111
sp|B3MM49|KRR1_DROAN KRR1 small subunit processome component homolog OS=Drosophila ananassae GN=dbe PE=3 SV=1 33 308 2.0E-111
sp|B4G9L6|KRR1_DROPE KRR1 small subunit processome component homolog OS=Drosophila persimilis GN=dbe PE=3 SV=1 33 317 1.0E-110
sp|B4LTY6|KRR1_DROVI KRR1 small subunit processome component homolog OS=Drosophila virilis GN=dbe PE=3 SV=1 33 318 4.0E-109
sp|Q54UU6|KRR1_DICDI KRR1 small subunit processome component homolog OS=Dictyostelium discoideum GN=krr1 PE=3 SV=1 23 311 5.0E-99
sp|Q57885|Y443_METJA KH domain-containing protein MJ0443 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0443 PE=3 SV=1 59 226 4.0E-10
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3005
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7649
Ophiocordyceps australis map64 (Brazil) OphauB2|6799
Ophiocordyceps camponoti-floridani Ophcf2|02844
Ophiocordyceps camponoti-rufipedis Ophun1|741 (this protein)
Ophiocordyceps kimflemingae Ophio5|5358
Ophiocordyceps subramaniannii Hirsu2|5162

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|741
MPKKPRKGDADNAAAEQPPVESEFKLDQKLGSAVVEESSFATLFPKYREVYLKEAWPLVTKALERRGIACTLDLI
EGSMTVKTTRKTCDPAAILDARDLIKLLARSVPAPQAIKILDEGVACDVIKIRNLVGNKDRFVKRRQRILGPNGS
TLKALELLTNTYILVHGNTVSAMGPYRGLREVRRVVEDCMANIHPIYHIKELMIKRELAKDPELANESWDRFLPN
FRKKTLSKRRVPLKVSDKSKKTYTPFPPAPEKSKIDKQMESGEYFLSKEAKDRAAQKERKEKQKERKLERAKERE
ADFVPPEEGGRPKKKRKKTEA*
Coding >Ophun1|741
ATGCCCAAGAAGCCGCGCAAAGGCGACGCAGACAATGCAGCCGCCGAACAACCCCCCGTCGAAAGCGAATTCAAG
CTCGACCAAAAGCTCGGCTCAGCCGTCGTCGAAGAGTCGTCCTTTGCAACCCTCTTCCCAAAATATCGCGAAGTC
TATCTCAAAGAGGCCTGGCCGCTGGTAACCAAGGCTCTCGAACGGCGCGGCATCGCCTGCACGCTGGACTTGATC
GAAGGCAGCATGACGGTCAAGACGACGCGAAAGACTTGCGATCCTGCTGCCATTCTTGACGCGCGAGACCTCATC
AAGCTGCTGGCACGAAGCGTTCCCGCGCCTCAGGCCATCAAGATCCTCGACGAGGGCGTTGCCTGCGATGTAATT
AAGATCCGCAACCTGGTCGGCAACAAAGACCGCTTCGTCAAGCGGCGACAGCGCATCCTCGGCCCCAACGGCTCT
ACCCTCAAAGCTCTCGAGCTCCTGACAAACACGTACATACTCGTCCACGGCAACACCGTCTCCGCCATGGGTCCC
TACCGCGGCCTCAGGGAGGTCCGGCGCGTGGTGGAGGATTGCATGGCCAACATCCACCCCATCTACCACATCAAA
GAGCTGATGATCAAGCGCGAGCTCGCAAAGGATCCCGAACTCGCCAACGAGAGCTGGGATCGCTTCCTGCCCAAC
TTTCGGAAAAAGACGCTCAGCAAGCGTCGCGTCCCGCTCAAGGTCTCGGACAAGAGCAAGAAGACGTACACGCCC
TTTCCGCCCGCGCCCGAGAAGAGCAAGATCGACAAGCAGATGGAGAGCGGCGAGTACTTTCTCTCCAAGGAGGCC
AAGGACCGCGCCGCTCAGAAGGAGCGCAAGGAGAAGCAGAAGGAGCGCAAGCTGGAGAGGGCCAAGGAGAGGGAG
GCGGACTTTGTGCCTCCGGAGGAAGGGGGGCGGCCCAAGAAGAAGCGGAAGAAGACCGAGGCATGA
Transcript >Ophun1|741
ATGCCCAAGAAGCCGCGCAAAGGCGACGCAGACAATGCAGCCGCCGAACAACCCCCCGTCGAAAGCGAATTCAAG
CTCGACCAAAAGCTCGGCTCAGCCGTCGTCGAAGAGTCGTCCTTTGCAACCCTCTTCCCAAAATATCGCGAAGTC
TATCTCAAAGAGGCCTGGCCGCTGGTAACCAAGGCTCTCGAACGGCGCGGCATCGCCTGCACGCTGGACTTGATC
GAAGGCAGCATGACGGTCAAGACGACGCGAAAGACTTGCGATCCTGCTGCCATTCTTGACGCGCGAGACCTCATC
AAGCTGCTGGCACGAAGCGTTCCCGCGCCTCAGGCCATCAAGATCCTCGACGAGGGCGTTGCCTGCGATGTAATT
AAGATCCGCAACCTGGTCGGCAACAAAGACCGCTTCGTCAAGCGGCGACAGCGCATCCTCGGCCCCAACGGCTCT
ACCCTCAAAGCTCTCGAGCTCCTGACAAACACGTACATACTCGTCCACGGCAACACCGTCTCCGCCATGGGTCCC
TACCGCGGCCTCAGGGAGGTCCGGCGCGTGGTGGAGGATTGCATGGCCAACATCCACCCCATCTACCACATCAAA
GAGCTGATGATCAAGCGCGAGCTCGCAAAGGATCCCGAACTCGCCAACGAGAGCTGGGATCGCTTCCTGCCCAAC
TTTCGGAAAAAGACGCTCAGCAAGCGTCGCGTCCCGCTCAAGGTCTCGGACAAGAGCAAGAAGACGTACACGCCC
TTTCCGCCCGCGCCCGAGAAGAGCAAGATCGACAAGCAGATGGAGAGCGGCGAGTACTTTCTCTCCAAGGAGGCC
AAGGACCGCGCCGCTCAGAAGGAGCGCAAGGAGAAGCAGAAGGAGCGCAAGCTGGAGAGGGCCAAGGAGAGGGAG
GCGGACTTTGTGCCTCCGGAGGAAGGGGGGCGGCCCAAGAAGAAGCGGAAGAAGACCGAGGCATGA
Gene >Ophun1|741
ATGCCCAAGAAGCCGCGCAAAGGCGACGCAGACAATGCAGCCGCCGAACAACCCCCCGTCGAAAGCGAATTCAAG
CTCGACCAAAAGCTCGGCTCAGCCGTCGTCGAAGAGTCGTCCTTTGCAACCCTCTTCCCAAAATATCGCGAAGTC
TATCTCAAAGAGGCCTGGCCGCTGGTAACCAAGGCTCTCGAACGGCGCGGCATCGCCTGCACGCTGGACTTGATC
GAAGGCAGCATGACGGTCAAGACGACGCGAAAGACTTGCGATCCTGCTGCCATTCTTGACGCGCGAGACCTCATC
AAGCTGCTGGCACGAAGCGTTCCCGCGCCTCAGGCCATCAAGATCCTCGACGAGGGCGTTGCCTGCGATGTAATT
AAGATCCGCAACCTGGTCGGCAACAAAGACCGCTTCGTCAAGCGGCGACAGCGCATCCTCGGCCCCAACGGCTCT
ACCCTCAAAGCTCTCGAGCTCCTGACAAACACGTACATACTCGTCCACGGCAACACCGTCTCCGCCATGGGTCCC
TACCGCGGCCTCAGGGAGGTCCGGCGCGTGGTGGAGGATTGCATGGCCAACATCCACCCCATCTACCACATCAAA
GAGCTGATGATCAAGCGCGAGCTCGCAAAGGATCCCGAACTCGCCAACGAGAGCTGGGATCGCTTCCTGCCCAAC
TTTCGGAAAAAGACGCTCAGCAAGCGTCGCGTCCCGCTCAAGGTCTCGGACAAGAGCAAGAAGACGTACACGCCC
TTTCCGCCCGCGCCCGAGAAGAGCAAGATCGACAAGCAGATGGAGAGCGGCGAGTACTTTCTCTCCAAGGAGGCC
AAGGACCGCGCCGCTCAGAAGGAGCGCAAGGAGAAGCAGAAGGAGCGCAAGCTGGAGAGGGCCAAGGAGAGGGAG
GCGGACTTTGTGCCTCCGGAGGAAGGGGGGCGGCCCAAGAAGAAGCGGAAGAAGACCGAGGCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail