Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7407
Gene name
LocationContig_924:1643..2993
Strand-
Gene length (bp)1350
Transcript length (bp)1170
Coding sequence length (bp)1170
Protein length (aa) 390

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04749 PLAC8 PLAC8 family 1.7E-08 64 158

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q6MW50|YB290_NEUCR Uncharacterized protein NCU10291 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B4B2.090 PE=4 SV=1 59 204 3.0E-10

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5238
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4750
Ophiocordyceps australis map64 (Brazil) OphauB2|6834
Ophiocordyceps camponoti-floridani Ophcf2|01619
Ophiocordyceps camponoti-rufipedis Ophun1|7407 (this protein)
Ophiocordyceps kimflemingae Ophio5|7578
Ophiocordyceps subramaniannii Hirsu2|4371

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7407
MDLHWTQNPRFSHLRTPPVWYNRYPEPLYSRKPSSVMEKLASSEARAKWQWEAIPGSRDVGFIKSCVTALLWPCG
AYARTSSRLHCALAGHNVETTPDPGFINPDCAQFGGCCPFYGCFLARMQTTVRSFYGIDGSAYSDWANGCCCPCL
TLVRNEREILVREKQRQLGSPHDPSAKYQSQSPMTCDQLKTFGGSPASPPKDGKKGKANLASTSDQDAKGNDGPL
GRNQNYRDQPLAIVPHQAAHELATDATVPSAPAGLAHGLDRDATTAQTTTALKHGLGEDAATTVASASRGHRLAD
DAATATGHTGTRHGLATDRPVTVGRPGTPHGLVDDAASAVGPGGGGAHRLSRDATVPSGGQRDGRHGLGADEEVP
VKTGLGGPHDMAAA*
Coding >Ophun1|7407
ATGGATCTTCACTGGACCCAGAATCCGCGCTTCAGCCACCTGCGAACACCTCCCGTGTGGTACAACCGCTATCCC
GAACCCCTCTACTCGCGCAAACCGTCGTCCGTCATGGAGAAGCTGGCGTCGTCCGAGGCTAGGGCCAAGTGGCAG
TGGGAGGCGATACCGGGCTCCCGCGACGTGGGCTTTATCAAATCATGCGTCACGGCTCTGCTCTGGCCATGCGGT
GCCTACGCCCGCACCTCGTCGCGCCTTCACTGTGCCTTGGCCGGTCATAATGTCGAGACGACGCCGGATCCGGGA
TTCATAAACCCCGACTGTGCCCAGTTCGGCGGCTGCTGCCCGTTCTACGGCTGTTTTCTGGCGCGAATGCAGACG
ACGGTGCGCTCCTTTTACGGCATCGATGGCAGCGCCTATTCGGACTGGGCCAACGGCTGCTGCTGCCCCTGCCTG
ACGCTGGTCCGCAACGAGCGCGAGATCTTGGTGCGCGAGAAGCAGCGCCAGCTGGGGTCGCCTCACGACCCGTCG
GCCAAGTATCAGTCGCAGTCGCCCATGACGTGCGACCAGCTCAAGACGTTTGGCGGCAGTCCAGCGAGCCCCCCA
AAAGATGGGAAAAAGGGCAAGGCCAACCTTGCCTCAACGTCGGATCAGGACGCGAAGGGAAACGATGGGCCTCTC
GGTCGCAATCAGAACTATCGCGACCAACCCTTGGCTATCGTACCACATCAGGCGGCTCACGAACTCGCGACCGAC
GCAACGGTGCCCAGCGCCCCAGCCGGGCTCGCACACGGTCTGGACCGGGATGCCACGACGGCGCAGACGACGACA
GCCTTGAAGCACGGCCTGGGCGAGGACGCCGCCACCACGGTCGCTTCAGCTTCTCGTGGCCACCGGCTGGCTGAC
GACGCGGCCACGGCGACCGGGCATACGGGAACGCGGCACGGACTGGCGACGGACCGACCCGTGACGGTGGGTCGT
CCGGGTACGCCTCACGGGCTCGTCGACGACGCGGCCTCGGCGGTGGGCCCCGGAGGCGGCGGCGCTCACAGGCTC
TCGCGCGACGCCACGGTGCCGTCTGGCGGTCAGCGGGACGGGCGGCACGGGCTGGGCGCGGACGAGGAGGTGCCG
GTAAAGACCGGGCTGGGCGGGCCTCACGACATGGCGGCCGCGTGA
Transcript >Ophun1|7407
ATGGATCTTCACTGGACCCAGAATCCGCGCTTCAGCCACCTGCGAACACCTCCCGTGTGGTACAACCGCTATCCC
GAACCCCTCTACTCGCGCAAACCGTCGTCCGTCATGGAGAAGCTGGCGTCGTCCGAGGCTAGGGCCAAGTGGCAG
TGGGAGGCGATACCGGGCTCCCGCGACGTGGGCTTTATCAAATCATGCGTCACGGCTCTGCTCTGGCCATGCGGT
GCCTACGCCCGCACCTCGTCGCGCCTTCACTGTGCCTTGGCCGGTCATAATGTCGAGACGACGCCGGATCCGGGA
TTCATAAACCCCGACTGTGCCCAGTTCGGCGGCTGCTGCCCGTTCTACGGCTGTTTTCTGGCGCGAATGCAGACG
ACGGTGCGCTCCTTTTACGGCATCGATGGCAGCGCCTATTCGGACTGGGCCAACGGCTGCTGCTGCCCCTGCCTG
ACGCTGGTCCGCAACGAGCGCGAGATCTTGGTGCGCGAGAAGCAGCGCCAGCTGGGGTCGCCTCACGACCCGTCG
GCCAAGTATCAGTCGCAGTCGCCCATGACGTGCGACCAGCTCAAGACGTTTGGCGGCAGTCCAGCGAGCCCCCCA
AAAGATGGGAAAAAGGGCAAGGCCAACCTTGCCTCAACGTCGGATCAGGACGCGAAGGGAAACGATGGGCCTCTC
GGTCGCAATCAGAACTATCGCGACCAACCCTTGGCTATCGTACCACATCAGGCGGCTCACGAACTCGCGACCGAC
GCAACGGTGCCCAGCGCCCCAGCCGGGCTCGCACACGGTCTGGACCGGGATGCCACGACGGCGCAGACGACGACA
GCCTTGAAGCACGGCCTGGGCGAGGACGCCGCCACCACGGTCGCTTCAGCTTCTCGTGGCCACCGGCTGGCTGAC
GACGCGGCCACGGCGACCGGGCATACGGGAACGCGGCACGGACTGGCGACGGACCGACCCGTGACGGTGGGTCGT
CCGGGTACGCCTCACGGGCTCGTCGACGACGCGGCCTCGGCGGTGGGCCCCGGAGGCGGCGGCGCTCACAGGCTC
TCGCGCGACGCCACGGTGCCGTCTGGCGGTCAGCGGGACGGGCGGCACGGGCTGGGCGCGGACGAGGAGGTGCCG
GTAAAGACCGGGCTGGGCGGGCCTCACGACATGGCGGCCGCGTGA
Gene >Ophun1|7407
ATGGATCTTCACTGGACCCAGAATCCGCGCTTCAGCCACCTGCGAACACCTCCCGTGTGGTACAACCGCTATCCC
GAACCCCTCTACTCGCGCAAACCGTCGTCCGTCATGGAGAAGCTGGCGTCGTCCGAGGCTAGGGCCAAGTGGCAG
TGGGAGGCGATACCGGGCTCCCGCGACGTGGGCTTTATCAAATCATGCGTCACGGCTCTGCTCTGGCCATGCGGT
GCCTACGCCCGCACCTCGTCGCGCCTTCACTGTGCCTTGGCCGGTCATAATGTCGAGACGACGCCGGATCCGGGA
TTCATAAACCCCGACTGTGCCCAGTTCGGCGGCTGCTGCCCGTGTAAGTCCTTTCGACGAGACTGTTGGTCGGTT
GTCGAGGGCTCCGTGCTGACGACTCGCCGTCAAGTCTACGGCTGTTTTCTGGCGCGAATGCAGACGACGGTGCGC
TCCTTTTACGGCATCGATGGCAGCGCCTATTCGGACTGGGCCAACGGCTGCTGCTGCCCCTGCCTGACGCTGGTC
CGCAACGAGCGCGAGATCTTGGTGCGCGAGAAGCAGCGCCAGCTGGGGTCGCCTCACGACCCGTCGGCCAAGTAT
CAGTCGCAGTCGCCCATGACGTGCGACCAGCTCAAGACGTTTGGCGGCAGTCCAGCGAGCCCCCCAAAAGATGGG
AAAAAGGGCAAGGCCAACCTTGCCTCAACGTCGGATCAGGACGCGAAGGGAAACGATGGGCCTCTCGGTCGCAAT
CAGAACTAGTATTTGGTGCCGGCCGACCAGCAGCCTTATACTGGAGCAGGCAAAGACTGGAGCGGATGCATTACA
GGAGCCGTCCCCATCACAGCTGTGGTGGTCGATCGTCACTCGCTCAGTCGCGACCAACCCTTGGCTATCGTACCA
CATCAGGCGGCTCACGAACTCGCGACCGACGCAACGGTGCCCAGCGCCCCAGCCGGGCTCGCACACGGTCTGGAC
CGGGATGCCACGACGGCGCAGACGACGACAGCCTTGAAGCACGGCCTGGGCGAGGACGCCGCCACCACGGTCGCT
TCAGCTTCTCGTGGCCACCGGCTGGCTGACGACGCGGCCACGGCGACCGGGCATACGGGAACGCGGCACGGACTG
GCGACGGACCGACCCGTGACGGTGGGTCGTCCGGGTACGCCTCACGGGCTCGTCGACGACGCGGCCTCGGCGGTG
GGCCCCGGAGGCGGCGGCGCTCACAGGCTCTCGCGCGACGCCACGGTGCCGTCTGGCGGTCAGCGGGACGGGCGG
CACGGGCTGGGCGCGGACGAGGAGGTGCCGGTAAAGACCGGGCTGGGCGGGCCTCACGACATGGCGGCCGCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail