Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7402
Gene name
LocationContig_922:256..1783
Strand+
Gene length (bp)1527
Transcript length (bp)1404
Coding sequence length (bp)1404
Protein length (aa) 468

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07967 zf-C3HC C3HC zinc finger-like 3.6E-34 107 246
PF08600 Rsm1 Rsm1-like 2.8E-23 285 366

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O94506|RSM1_SCHPO mRNA export factor rsm1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rsm1 PE=4 SV=1 105 354 1.0E-11
sp|Q6P7H4|NIPA_XENLA NIPA-like protein OS=Xenopus laevis GN=zc3hc1 PE=2 SV=1 105 345 5.0E-07
sp|Q5M8S7|NIPA_XENTR NIPA-like protein OS=Xenopus tropicalis GN=zc3hc1 PE=2 SV=1 76 348 6.0E-07

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0046872 metal ion binding No
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0046914 transition metal ion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7402
MNATKRKFNALLQGLSNPSTPERTTMADHGGLSPSSSASDALLLKRRRLGIPGAKPNVGDAGGSSSLPSTPFSSL
RKTGSVINNNNNKASQLKPTTASVDALIKYCPADRDQLLKRLATFQELTDWTPKPDRVNEVEWARRGWVCRGKEK
VGCLLCHKELLVTLNRKEVDGQQVSILVSSEIDEAVVDKYSHLILTSHQQDCLWRKRGCDESLLRLSFSSDRTVL
ANLRQRYDELCTRAAFLPYQVNLRLPAGTDIDRVLSLLPPDFFADSTPSADEPKAVNRPALSLALLGWQGLTHAR
LGSVPNSASCHSCLRRLGLWMFKSKEVADDGTVLVPAPMDHLDPLREHRFFCPWKSADVQSKGAKSAWTMLLQTI
VNDASLRDLYEGRKPAPPTTTDAAASPPALDAPSVIIDDEADEKARDAKDKERWARLRKVKSLFDTKGAKMLRRS
VSISRPDAGQSSISSGA*
Coding >Ophun1|7402
ATGAACGCGACAAAGCGCAAGTTCAACGCTCTCCTCCAAGGCCTAAGCAACCCCTCGACCCCCGAACGAACCACC
ATGGCCGATCACGGCGGACTCTCTCCCTCGTCGTCCGCCAGTGACGCTCTGCTCCTGAAACGTCGTCGGCTGGGG
ATCCCGGGGGCGAAGCCGAATGTTGGTGATGCGGGTGGCTCGTCGTCGTTGCCGTCGACTCCGTTTTCGAGTCTG
AGGAAGACTGGCAGCGTCATCAATAATAATAATAACAAGGCTTCGCAGCTCAAGCCGACGACGGCCTCGGTTGAC
GCCCTCATCAAATATTGTCCCGCCGATCGGGACCAGTTGCTCAAGAGGCTCGCCACCTTTCAAGAGCTGACGGAC
TGGACGCCCAAGCCCGACAGGGTCAACGAAGTGGAATGGGCCCGTCGCGGATGGGTCTGTCGTGGCAAGGAGAAA
GTTGGCTGTCTTCTGTGTCACAAAGAGCTGCTCGTCACGCTCAATCGGAAGGAAGTCGATGGCCAGCAGGTTTCC
ATCCTGGTGTCTTCGGAAATCGACGAGGCCGTCGTCGACAAATACAGTCATCTCATCCTCACCTCGCACCAGCAA
GACTGTCTCTGGCGAAAACGAGGCTGCGATGAGTCTCTGCTGCGACTGTCCTTCTCCAGCGACAGGACCGTCCTC
GCCAACCTCCGCCAGCGATACGATGAACTCTGCACTAGAGCCGCCTTTCTCCCCTACCAAGTCAACCTCCGACTC
CCCGCCGGGACAGACATCGACCGCGTGCTTTCCCTCCTCCCGCCCGACTTCTTTGCGGATTCAACCCCGTCGGCC
GACGAGCCCAAAGCCGTCAACCGTCCCGCGCTGTCTCTAGCTCTCCTGGGGTGGCAAGGACTCACACACGCTCGC
CTCGGCTCCGTGCCCAACTCAGCCTCGTGCCATTCCTGTCTTCGCCGGCTCGGCCTCTGGATGTTCAAGAGCAAA
GAGGTAGCCGACGATGGCACCGTCCTCGTTCCCGCCCCGATGGATCACCTCGACCCCCTCCGCGAGCACCGCTTC
TTCTGCCCGTGGAAGAGCGCCGACGTCCAGAGCAAAGGCGCCAAGTCAGCCTGGACCATGCTCCTCCAGACCATC
GTCAACGACGCCAGCCTCCGCGATCTGTACGAAGGTCGAAAGCCAGCACCACCTACGACGACCGACGCCGCAGCC
TCTCCCCCCGCGCTCGACGCCCCCTCCGTAATCATCGACGACGAAGCCGACGAGAAAGCGCGGGATGCCAAGGAC
AAGGAACGATGGGCCAGACTGAGAAAGGTCAAGAGCCTCTTTGACACAAAGGGGGCCAAGATGCTACGTCGCTCC
GTCTCTATCAGCAGGCCTGATGCAGGCCAGTCGAGTATCTCGAGCGGCGCTTAG
Transcript >Ophun1|7402
ATGAACGCGACAAAGCGCAAGTTCAACGCTCTCCTCCAAGGCCTAAGCAACCCCTCGACCCCCGAACGAACCACC
ATGGCCGATCACGGCGGACTCTCTCCCTCGTCGTCCGCCAGTGACGCTCTGCTCCTGAAACGTCGTCGGCTGGGG
ATCCCGGGGGCGAAGCCGAATGTTGGTGATGCGGGTGGCTCGTCGTCGTTGCCGTCGACTCCGTTTTCGAGTCTG
AGGAAGACTGGCAGCGTCATCAATAATAATAATAACAAGGCTTCGCAGCTCAAGCCGACGACGGCCTCGGTTGAC
GCCCTCATCAAATATTGTCCCGCCGATCGGGACCAGTTGCTCAAGAGGCTCGCCACCTTTCAAGAGCTGACGGAC
TGGACGCCCAAGCCCGACAGGGTCAACGAAGTGGAATGGGCCCGTCGCGGATGGGTCTGTCGTGGCAAGGAGAAA
GTTGGCTGTCTTCTGTGTCACAAAGAGCTGCTCGTCACGCTCAATCGGAAGGAAGTCGATGGCCAGCAGGTTTCC
ATCCTGGTGTCTTCGGAAATCGACGAGGCCGTCGTCGACAAATACAGTCATCTCATCCTCACCTCGCACCAGCAA
GACTGTCTCTGGCGAAAACGAGGCTGCGATGAGTCTCTGCTGCGACTGTCCTTCTCCAGCGACAGGACCGTCCTC
GCCAACCTCCGCCAGCGATACGATGAACTCTGCACTAGAGCCGCCTTTCTCCCCTACCAAGTCAACCTCCGACTC
CCCGCCGGGACAGACATCGACCGCGTGCTTTCCCTCCTCCCGCCCGACTTCTTTGCGGATTCAACCCCGTCGGCC
GACGAGCCCAAAGCCGTCAACCGTCCCGCGCTGTCTCTAGCTCTCCTGGGGTGGCAAGGACTCACACACGCTCGC
CTCGGCTCCGTGCCCAACTCAGCCTCGTGCCATTCCTGTCTTCGCCGGCTCGGCCTCTGGATGTTCAAGAGCAAA
GAGGTAGCCGACGATGGCACCGTCCTCGTTCCCGCCCCGATGGATCACCTCGACCCCCTCCGCGAGCACCGCTTC
TTCTGCCCGTGGAAGAGCGCCGACGTCCAGAGCAAAGGCGCCAAGTCAGCCTGGACCATGCTCCTCCAGACCATC
GTCAACGACGCCAGCCTCCGCGATCTGTACGAAGGTCGAAAGCCAGCACCACCTACGACGACCGACGCCGCAGCC
TCTCCCCCCGCGCTCGACGCCCCCTCCGTAATCATCGACGACGAAGCCGACGAGAAAGCGCGGGATGCCAAGGAC
AAGGAACGATGGGCCAGACTGAGAAAGGTCAAGAGCCTCTTTGACACAAAGGGGGCCAAGATGCTACGTCGCTCC
GTCTCTATCAGCAGGCCTGATGCAGGCCAGTCGAGTATCTCGAGCGGCGCTTAG
Gene >Ophun1|7402
ATGAACGCGACAAAGCGCAAGTTCAACGCTCTCCTCCAAGGCCTAAGCAACCCCTCGACCCCCGAACGAACCACC
ATGGCCGATCACGGCGGACTCTCTCCCTCGTCGTCCGCCAGTGACGCTCTGCTCCTGAAACGTCGTCGGCTGGGG
ATCCCGGGGGCGAAGCCGAATGTTGGTGATGCGGGTGGCTCGTCGTCGTTGCCGTCGACTCCGTTTTCGAGTCTG
AGGAAGACTGGCAGCGTCATCAATAATAATAATAACAAGGCTTCGCAGCTCAAGCCGACGACGGCCTCGGTTGAC
GCCCTCATCAAATATTGTCCCGCCGATCGGGACCAGTTGCTCAAGAGGCTCGCCACCTTTCAAGAGCTGACGGAC
TGGACGCCCAAGCCCGACAGGGTCAACGAAGTGGAATGGGCCCGTCGCGGATGGGTCTGTCGTGGCAAGGAGAAA
GTTGGCTGTCTTCTGTGTCACAAAGAGCTGCTCGTCACGCTCAATCGGAAGGAAGTCGATGGCCAGCAGGTTTCC
ATCCTGGTGTCTTCGGAAATCGGTTCGTTTTTGTTTCGCGTCTCTGCCTGCGCAGTCACTGACGTTGTTTACTCA
AAGACGAGGCCGTCGTCGACAAATACAGTCATCTCATCCTCACCTCGCACCAGCAAGACTGTCTCTGGCGAAAAC
GAGGCTGCGATGGTAAAACCCCCCCTTTCTTTCTTTATCTGTCTTGCCGCCTTCTAACCCGTATCTTGGTTTCTC
ATAGAGTCTCTGCTGCGACTGTCCTTCTCCAGCGACAGGACCGTCCTCGCCAACCTCCGCCAGCGATACGATGAA
CTCTGCACTAGAGCCGCCTTTCTCCCCTACCAAGTCAACCTCCGACTCCCCGCCGGGACAGACATCGACCGCGTG
CTTTCCCTCCTCCCGCCCGACTTCTTTGCGGATTCAACCCCGTCGGCCGACGAGCCCAAAGCCGTCAACCGTCCC
GCGCTGTCTCTAGCTCTCCTGGGGTGGCAAGGACTCACACACGCTCGCCTCGGCTCCGTGCCCAACTCAGCCTCG
TGCCATTCCTGTCTTCGCCGGCTCGGCCTCTGGATGTTCAAGAGCAAAGAGGTAGCCGACGATGGCACCGTCCTC
GTTCCCGCCCCGATGGATCACCTCGACCCCCTCCGCGAGCACCGCTTCTTCTGCCCGTGGAAGAGCGCCGACGTC
CAGAGCAAAGGCGCCAAGTCAGCCTGGACCATGCTCCTCCAGACCATCGTCAACGACGCCAGCCTCCGCGATCTG
TACGAAGGTCGAAAGCCAGCACCACCTACGACGACCGACGCCGCAGCCTCTCCCCCCGCGCTCGACGCCCCCTCC
GTAATCATCGACGACGAAGCCGACGAGAAAGCGCGGGATGCCAAGGACAAGGAACGATGGGCCAGACTGAGAAAG
GTCAAGAGCCTCTTTGACACAAAGGGGGCCAAGATGCTACGTCGCTCCGTCTCTATCAGCAGGCCTGATGCAGGC
CAGTCGAGTATCTCGAGCGGCGCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail