Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|74
Gene name
LocationContig_10:35394..37238
Strand+
Gene length (bp)1844
Transcript length (bp)1677
Coding sequence length (bp)1677
Protein length (aa) 559

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01417 ENTH ENTH domain 3.0E-50 15 139
PF08226 DUF1720 Domain of unknown function (DUF1720) 3.5E-05 259 320

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74423|ENT1_SCHPO Epsin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ent1 PE=1 SV=1 8 140 2.0E-52
sp|Q9Z1Z3|EPN2_RAT Epsin-2 OS=Rattus norvegicus GN=Epn2 PE=1 SV=1 2 351 3.0E-50
sp|Q12518|ENT1_YEAST Epsin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENT1 PE=1 SV=1 1 239 1.0E-49
sp|Q80VP1|EPN1_MOUSE Epsin-1 OS=Mus musculus GN=Epn1 PE=1 SV=3 2 281 1.0E-48
sp|O88339|EPN1_RAT Epsin-1 OS=Rattus norvegicus GN=Epn1 PE=1 SV=1 2 234 1.0E-48
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74423|ENT1_SCHPO Epsin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ent1 PE=1 SV=1 8 140 2.0E-52
sp|Q9Z1Z3|EPN2_RAT Epsin-2 OS=Rattus norvegicus GN=Epn2 PE=1 SV=1 2 351 3.0E-50
sp|Q12518|ENT1_YEAST Epsin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENT1 PE=1 SV=1 1 239 1.0E-49
sp|Q80VP1|EPN1_MOUSE Epsin-1 OS=Mus musculus GN=Epn1 PE=1 SV=3 2 281 1.0E-48
sp|O88339|EPN1_RAT Epsin-1 OS=Rattus norvegicus GN=Epn1 PE=1 SV=1 2 234 1.0E-48
sp|Q9Y6I3|EPN1_HUMAN Epsin-1 OS=Homo sapiens GN=EPN1 PE=1 SV=2 2 298 1.0E-48
sp|Q9H201|EPN3_HUMAN Epsin-3 OS=Homo sapiens GN=EPN3 PE=2 SV=1 2 246 6.0E-48
sp|O95208|EPN2_HUMAN Epsin-2 OS=Homo sapiens GN=EPN2 PE=1 SV=3 2 154 1.0E-47
sp|Q4V882|EPN3_RAT Epsin-3 OS=Rattus norvegicus GN=Epn3 PE=1 SV=1 2 154 2.0E-47
sp|Q91W69|EPN3_MOUSE Epsin-3 OS=Mus musculus GN=Epn3 PE=1 SV=1 2 154 2.0E-47
sp|Q8CHU3|EPN2_MOUSE Epsin-2 OS=Mus musculus GN=Epn2 PE=1 SV=1 2 154 1.0E-46
sp|Q8IYW4|ENTD1_HUMAN ENTH domain-containing protein 1 OS=Homo sapiens GN=ENTHD1 PE=2 SV=1 6 143 4.0E-36
sp|Q67YI9|EPN2_ARATH Clathrin interactor EPSIN 2 OS=Arabidopsis thaliana GN=EPSIN2 PE=1 SV=1 4 248 9.0E-32
sp|P47160|ENT3_YEAST Epsin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENT3 PE=1 SV=1 3 156 4.0E-31
sp|Q99KN9|EPN4_MOUSE Clathrin interactor 1 OS=Mus musculus GN=Clint1 PE=1 SV=2 10 143 6.0E-31
sp|A7Z035|EPN4_BOVIN Clathrin interactor 1 OS=Bos taurus GN=CLINT1 PE=2 SV=1 3 143 7.0E-31
sp|Q14677|EPN4_HUMAN Clathrin interactor 1 OS=Homo sapiens GN=CLINT1 PE=1 SV=1 10 143 8.0E-31
sp|Q93YP4|EPN3_ARATH Clathrin interactor EPSIN 3 OS=Arabidopsis thaliana GN=EPSIN3 PE=2 SV=1 21 244 1.0E-30
sp|Q54EH1|EPN_DICDI Epsin OS=Dictyostelium discoideum GN=epnA PE=3 SV=1 21 156 7.0E-30
sp|P78813|YCTB_SCHPO ENTH domain-containing protein C794.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.11c PE=1 SV=2 1 156 2.0E-29
sp|Q8VY07|EPN1_ARATH Clathrin interactor EPSIN 1 OS=Arabidopsis thaliana GN=EPSIN1 PE=1 SV=1 21 156 2.0E-23
sp|Q12518|ENT1_YEAST Epsin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENT1 PE=1 SV=1 416 524 2.0E-18
sp|Q05785|ENT2_YEAST Epsin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENT2 PE=1 SV=1 451 539 2.0E-16
sp|O74423|ENT1_SCHPO Epsin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ent1 PE=1 SV=1 259 519 2.0E-10
sp|Q07872|ENT4_YEAST Epsin-4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENT4 PE=1 SV=1 16 122 6.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|74
MSKVMRSVKNVTKGYSSTQVKVREATSNDPWGPTGTQMSEIAQMTFNTSTEFYDIMDMVDKRLNDKGKNWRHVLK
ALKVLDYCLHEGSEMVVTWARQNVYIIKTLREFQYIDEDGRDVGQNVRVAAKELTSLILDENRLRAERSDRRTWK
SRVSGLEDHPPPQHGQHSQHGGQYGAEAPDPRRLPKRPVGDEDDTEYRLAIEASKQQEEEDRRKREGQNNDDDLA
KAIKLSKEEEERRRRALEDGNASLFDDDLLQLDQPQYTGFNQGYQQGNQVDFFANPIDQSQMQAQPTGYPYAGFQ
TQPTGFQPQPTGFQPQPTGFQPGYGMDPYGQHGMQGFQPQPTGFNPYAQQQLSMQTGAVAEPTLQPGSNNPWASN
NSQQQQQQALKPAATGSNNPFASGTQFGRPATAKPALSSLGSLPEREPLASFSQPKPRPQPQPQPQPQSYNPPPQ
KNMTDYESKLNSLLATGDGMDTYGNTGELRIPAQHTAPGTYANSAGSGVQRLNAEPTGSNPFMRQQFTGMPTVSY
GAQASSATGAGGANPFGAQRPQQQASNQDLIQF*
Coding >Ophun1|74
ATGTCCAAGGTAATGCGCAGCGTCAAAAATGTGACCAAGGGCTATTCCAGCACTCAGGTCAAGGTCAGGGAGGCC
ACGAGCAATGATCCCTGGGGCCCGACGGGCACCCAGATGAGCGAAATAGCCCAGATGACTTTCAACACGTCGACC
GAGTTCTACGACATTATGGACATGGTAGATAAGCGACTAAACGACAAGGGCAAGAACTGGCGGCACGTTCTCAAG
GCTCTCAAGGTCCTCGACTACTGTCTTCACGAGGGATCCGAAATGGTCGTCACTTGGGCTCGCCAAAATGTCTAC
ATCATCAAGACGCTGCGCGAGTTCCAGTATATTGACGAGGATGGTCGCGACGTGGGCCAAAATGTCCGCGTTGCC
GCCAAGGAGCTCACATCTTTGATCCTCGACGAGAACCGACTTCGCGCCGAACGCAGCGACCGTAGAACATGGAAA
TCTCGTGTCAGTGGTCTGGAGGATCACCCCCCGCCGCAGCATGGTCAGCACAGTCAGCATGGGGGGCAATACGGA
GCTGAAGCTCCTGATCCGCGGCGGCTCCCGAAGCGGCCTGTGGGAGATGAAGATGATACCGAGTATCGGCTGGCC
ATCGAGGCCAGCAAGCAGCAGGAAGAGGAGGACAGGAGAAAAAGGGAAGGCCAGAACAACGACGACGACTTGGCA
AAGGCTATCAAGCTCAGTAAGGAAGAGGAGGAGAGGAGGCGTCGGGCACTCGAAGATGGAAACGCCTCTCTGTTT
GACGACGATTTGCTGCAGCTTGACCAGCCGCAGTATACTGGCTTCAACCAGGGCTATCAGCAAGGAAACCAGGTC
GACTTCTTCGCCAATCCCATCGACCAGAGCCAAATGCAAGCACAGCCCACCGGATATCCCTATGCCGGCTTTCAG
ACACAGCCGACTGGTTTCCAGCCCCAACCGACGGGCTTCCAGCCTCAACCCACCGGTTTCCAGCCCGGCTATGGT
ATGGATCCTTATGGCCAGCACGGCATGCAAGGTTTCCAGCCGCAGCCGACGGGCTTCAACCCCTACGCTCAACAG
CAGCTGTCGATGCAGACGGGGGCCGTGGCTGAGCCCACTCTCCAGCCAGGAAGCAATAATCCTTGGGCCTCTAAC
AACTCGCAGCAGCAGCAGCAGCAGGCTCTGAAGCCGGCCGCGACTGGTTCCAACAATCCGTTCGCCTCTGGAACC
CAATTCGGCCGTCCTGCCACAGCCAAGCCCGCCTTATCTTCGCTAGGGTCGTTGCCTGAACGAGAGCCCCTGGCT
TCGTTCAGTCAGCCCAAGCCACGGCCGCAACCGCAACCGCAGCCGCAGCCGCAGTCGTACAATCCGCCGCCGCAG
AAGAACATGACGGACTACGAGTCCAAGCTCAACTCCCTTCTTGCCACTGGCGATGGTATGGACACGTACGGCAAC
ACCGGCGAGCTCCGGATTCCGGCCCAGCACACAGCACCGGGAACGTATGCCAACAGCGCCGGGTCGGGGGTGCAA
CGGTTAAACGCGGAGCCGACCGGAAGCAACCCTTTCATGAGACAGCAGTTCACCGGCATGCCGACCGTCAGCTAC
GGCGCCCAGGCCTCTTCGGCCACGGGAGCAGGCGGCGCCAATCCTTTCGGAGCTCAGCGGCCACAGCAACAAGCG
TCCAACCAGGACCTCATTCAGTTCTGA
Transcript >Ophun1|74
ATGTCCAAGGTAATGCGCAGCGTCAAAAATGTGACCAAGGGCTATTCCAGCACTCAGGTCAAGGTCAGGGAGGCC
ACGAGCAATGATCCCTGGGGCCCGACGGGCACCCAGATGAGCGAAATAGCCCAGATGACTTTCAACACGTCGACC
GAGTTCTACGACATTATGGACATGGTAGATAAGCGACTAAACGACAAGGGCAAGAACTGGCGGCACGTTCTCAAG
GCTCTCAAGGTCCTCGACTACTGTCTTCACGAGGGATCCGAAATGGTCGTCACTTGGGCTCGCCAAAATGTCTAC
ATCATCAAGACGCTGCGCGAGTTCCAGTATATTGACGAGGATGGTCGCGACGTGGGCCAAAATGTCCGCGTTGCC
GCCAAGGAGCTCACATCTTTGATCCTCGACGAGAACCGACTTCGCGCCGAACGCAGCGACCGTAGAACATGGAAA
TCTCGTGTCAGTGGTCTGGAGGATCACCCCCCGCCGCAGCATGGTCAGCACAGTCAGCATGGGGGGCAATACGGA
GCTGAAGCTCCTGATCCGCGGCGGCTCCCGAAGCGGCCTGTGGGAGATGAAGATGATACCGAGTATCGGCTGGCC
ATCGAGGCCAGCAAGCAGCAGGAAGAGGAGGACAGGAGAAAAAGGGAAGGCCAGAACAACGACGACGACTTGGCA
AAGGCTATCAAGCTCAGTAAGGAAGAGGAGGAGAGGAGGCGTCGGGCACTCGAAGATGGAAACGCCTCTCTGTTT
GACGACGATTTGCTGCAGCTTGACCAGCCGCAGTATACTGGCTTCAACCAGGGCTATCAGCAAGGAAACCAGGTC
GACTTCTTCGCCAATCCCATCGACCAGAGCCAAATGCAAGCACAGCCCACCGGATATCCCTATGCCGGCTTTCAG
ACACAGCCGACTGGTTTCCAGCCCCAACCGACGGGCTTCCAGCCTCAACCCACCGGTTTCCAGCCCGGCTATGGT
ATGGATCCTTATGGCCAGCACGGCATGCAAGGTTTCCAGCCGCAGCCGACGGGCTTCAACCCCTACGCTCAACAG
CAGCTGTCGATGCAGACGGGGGCCGTGGCTGAGCCCACTCTCCAGCCAGGAAGCAATAATCCTTGGGCCTCTAAC
AACTCGCAGCAGCAGCAGCAGCAGGCTCTGAAGCCGGCCGCGACTGGTTCCAACAATCCGTTCGCCTCTGGAACC
CAATTCGGCCGTCCTGCCACAGCCAAGCCCGCCTTATCTTCGCTAGGGTCGTTGCCTGAACGAGAGCCCCTGGCT
TCGTTCAGTCAGCCCAAGCCACGGCCGCAACCGCAACCGCAGCCGCAGCCGCAGTCGTACAATCCGCCGCCGCAG
AAGAACATGACGGACTACGAGTCCAAGCTCAACTCCCTTCTTGCCACTGGCGATGGTATGGACACGTACGGCAAC
ACCGGCGAGCTCCGGATTCCGGCCCAGCACACAGCACCGGGAACGTATGCCAACAGCGCCGGGTCGGGGGTGCAA
CGGTTAAACGCGGAGCCGACCGGAAGCAACCCTTTCATGAGACAGCAGTTCACCGGCATGCCGACCGTCAGCTAC
GGCGCCCAGGCCTCTTCGGCCACGGGAGCAGGCGGCGCCAATCCTTTCGGAGCTCAGCGGCCACAGCAACAAGCG
TCCAACCAGGACCTCATTCAGTTCTGA
Gene >Ophun1|74
ATGTCCAAGGTAATGCGCAGCGTCAAAAATGTGACCAAGGGCTATTCCAGCACTCAGGTCAAGGTCAGGGAGGGT
GGGTTGAGTCTCGAGACGTCGCTATTCGTGCGCTGACCCACGTCGCAGCCACGAGCAATGATCCCTGGGGCCCGA
CGGGCACCCAGATGAGCGAAATAGCCCAGATGACTTTCAACACGTACGAAGCCTCCCTCCCGCAAAGATGGCGCC
GCTGACTGACTTACTCTCGTCTCAGGTCGACCGAGTTCTACGACATTATGGACATGGTAGATAAGCGACTAAACG
ACAAGGGCAAGAACTGGCGGCACGTTCTCAAGGCTCTCAAGGTCCTCGACTACTGTCTTCACGAGGGATCCGAAA
TGGTCGTCACTTGGGCTCGCCAAAATGTCTACATCATCAAGACGCTGCGCGAGTTCCAGTATATTGACGAGGATG
GTCGCGACGTGGGCCAAAATGGTAAACCCATCCGCCCCAAAACCCTCCCAATGCCGAGTCTTGTTTACTGACGTT
GCCAAGTCCGCGTTGCCGCCAAGGAGCTCACATCTTTGATCCTCGACGAGAACCGACTTCGCGCCGAACGCAGCG
ACCGTAGAACATGGAAATCTCGTGTCAGTGGTCTGGAGGATCACCCCCCGCCGCAGCATGGTCAGCACAGTCAGC
ATGGGGGGCAATACGGAGCTGAAGCTCCTGATCCGCGGCGGCTCCCGAAGCGGCCTGTGGGAGATGAAGATGATA
CCGAGTATCGGCTGGCCATCGAGGCCAGCAAGCAGCAGGAAGAGGAGGACAGGAGAAAAAGGGAAGGCCAGAACA
ACGACGACGACTTGGCAAAGGCTATCAAGCTCAGTAAGGAAGAGGAGGAGAGGAGGCGTCGGGCACTCGAAGATG
GAAACGCCTCTCTGTTTGACGACGATTTGCTGCAGCTTGACCAGCCGCAGTATACTGGCTTCAACCAGGGCTATC
AGCAAGGAAACCAGGTCGACTTCTTCGCCAATCCCATCGACCAGAGCCAAATGCAAGCACAGCCCACCGGATATC
CCTATGCCGGCTTTCAGACACAGCCGACTGGTTTCCAGCCCCAACCGACGGGCTTCCAGCCTCAACCCACCGGTT
TCCAGCCCGGCTATGGTATGGATCCTTATGGCCAGCACGGCATGCAAGGTTTCCAGCCGCAGCCGACGGGCTTCA
ACCCCTACGCTCAACAGCAGCTGTCGATGCAGACGGGGGCCGTGGCTGAGCCCACTCTCCAGCCAGGAAGCAATA
ATCCTTGGGCCTCTAACAACTCGCAGCAGCAGCAGCAGCAGGCTCTGAAGCCGGCCGCGACTGGTTCCAACAATC
CGTTCGCCTCTGGAACCCAATTCGGCCGTCCTGCCACAGCCAAGCCCGCCTTATCTTCGCTAGGGTCGTTGCCTG
AACGAGAGCCCCTGGCTTCGTTCAGTCAGCCCAAGCCACGGCCGCAACCGCAACCGCAGCCGCAGCCGCAGTCGT
ACAATCCGCCGCCGCAGAAGAACATGACGGACTACGAGTCCAAGCTCAACTCCCTTCTTGCCACTGGCGATGGTA
TGGACACGTACGGCAACACCGGCGAGCTCCGGATTCCGGCCCAGCACACAGCACCGGGAACGTATGCCAACAGCG
CCGGGTCGGGGGTGCAACGGTTAAACGCGGAGCCGACCGGAAGCAACCCTTTCATGAGACAGCAGTTCACCGGCA
TGCCGACCGTCAGCTACGGCGCCCAGGCCTCTTCGGCCACGGGAGCAGGCGGCGCCAATCCTTTCGGAGCTCAGC
GGCCACAGCAACAAGCGTCCAACCAGGACCTCATTCAGTTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail