Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7396
Gene name
LocationContig_92:29960..34371
Strand-
Gene length (bp)4411
Transcript length (bp)4179
Coding sequence length (bp)4179
Protein length (aa) 1393

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17846 XRN_M Xrn1 helical domain 7.2E-96 270 669
PF03159 XRN_N XRN 5'-3' exonuclease N-terminus 2.3E-86 1 222
PF18332 XRN1_D1 Exoribonuclease Xrn1 D1 domain 5.3E-71 720 908
PF18334 XRN1_D2_D3 Exoribonuclease Xrn1 D2/D3 domain 2.8E-34 912 997
PF18194 Xrn1_D3 Exoribonuclease 1 Domain-3 3.2E-21 1078 1148
PF18129 SH3_12 Xrn1 SH3-like domain 5.5E-20 1155 1225

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P22147|XRN1_YEAST 5'-3' exoribonuclease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=XRN1 PE=1 SV=1 1 1240 0.0E+00
sp|P40383|XRN1_SCHPO 5'-3' exoribonuclease 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=exo2 PE=1 SV=1 1 1243 0.0E+00
sp|P97789|XRN1_MOUSE 5'-3' exoribonuclease 1 OS=Mus musculus GN=Xrn1 PE=1 SV=1 1 1228 0.0E+00
sp|Q8IZH2|XRN1_HUMAN 5'-3' exoribonuclease 1 OS=Homo sapiens GN=XRN1 PE=1 SV=1 1 1251 0.0E+00
sp|Q5BFH3|XRN2_EMENI 5'-3' exoribonuclease 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rat1 PE=3 SV=3 1 671 1.0E-141
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P22147|XRN1_YEAST 5'-3' exoribonuclease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=XRN1 PE=1 SV=1 1 1240 0.0E+00
sp|P40383|XRN1_SCHPO 5'-3' exoribonuclease 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=exo2 PE=1 SV=1 1 1243 0.0E+00
sp|P97789|XRN1_MOUSE 5'-3' exoribonuclease 1 OS=Mus musculus GN=Xrn1 PE=1 SV=1 1 1228 0.0E+00
sp|Q8IZH2|XRN1_HUMAN 5'-3' exoribonuclease 1 OS=Homo sapiens GN=XRN1 PE=1 SV=1 1 1251 0.0E+00
sp|Q5BFH3|XRN2_EMENI 5'-3' exoribonuclease 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rat1 PE=3 SV=3 1 671 1.0E-141
sp|Q8TFZ1|XRN2_ASPFU 5'-3' exoribonuclease 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rat1 PE=3 SV=4 1 671 5.0E-138
sp|Q5AMG5|XRN2_CANAL 5'-3' exoribonuclease 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RAT1 PE=3 SV=3 1 744 2.0E-134
sp|Q2GNZ6|XRN2_CHAGB 5'-3' exoribonuclease 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=RAT1 PE=3 SV=3 1 698 1.0E-133
sp|Q6BNU7|XRN2_DEBHA 5'-3' exoribonuclease 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RAT1 PE=3 SV=4 1 685 2.0E-133
sp|Q9FQ03|XRN3_ARATH 5'-3' exoribonuclease 3 OS=Arabidopsis thaliana GN=XRN3 PE=2 SV=1 1 681 8.0E-132
sp|Q9FQ02|XRN2_ARATH 5'-3' exoribonuclease 2 OS=Arabidopsis thaliana GN=XRN2 PE=2 SV=1 1 680 2.0E-128
sp|Q9U299|XRN2_CAEEL 5'-3' exoribonuclease 2 homolog OS=Caenorhabditis elegans GN=xrn-2 PE=1 SV=2 1 671 8.0E-128
sp|Q4HWE2|XRN2_GIBZE 5'-3' exoribonuclease 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RAT1 PE=3 SV=3 1 671 3.0E-124
sp|P40848|XRN2_SCHPO 5'-3' exoribonuclease 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dhp1 PE=1 SV=1 1 676 5.0E-124
sp|Q8WZX5|XRN2_NEUCR 5'-3' exoribonuclease 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=exr-1 PE=3 SV=3 1 671 2.0E-122
sp|Q5ZIP4|XRN2_CHICK 5'-3' exoribonuclease 2 OS=Gallus gallus GN=XRN2 PE=2 SV=1 1 677 1.0E-120
sp|Q6C961|XRN2_YARLI 5'-3' exoribonuclease 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RAT1 PE=3 SV=3 1 668 1.0E-118
sp|Q9H0D6|XRN2_HUMAN 5'-3' exoribonuclease 2 OS=Homo sapiens GN=XRN2 PE=1 SV=1 1 786 3.0E-118
sp|Q9DBR1|XRN2_MOUSE 5'-3' exoribonuclease 2 OS=Mus musculus GN=Xrn2 PE=1 SV=1 1 786 1.0E-117
sp|Q5R4L5|XRN2_PONAB 5'-3' exoribonuclease 2 OS=Pongo abelii GN=XRN2 PE=2 SV=1 1 786 5.0E-115
sp|Q60SG7|XRN2_CAEBR 5'-3' exoribonuclease 2 homolog OS=Caenorhabditis briggsae GN=xrn-2 PE=3 SV=2 1 366 4.0E-87
sp|Q9VM71|XRN2_DROME 5'-3' exoribonuclease 2 homolog OS=Drosophila melanogaster GN=Rat1 PE=1 SV=2 1 389 7.0E-87
sp|Q02792|XRN2_YEAST 5'-3' exoribonuclease 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAT1 PE=1 SV=3 1 344 4.0E-83
sp|Q6CKX0|XRN2_KLULA 5'-3' exoribonuclease 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAT1 PE=3 SV=3 1 344 2.0E-81
sp|Q74ZA0|XRN2_ASHGO 5'-3' exoribonuclease 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RAT1 PE=3 SV=4 1 376 5.0E-81
sp|Q6FKN6|XRN2_CANGA 5'-3' exoribonuclease 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RAT1 PE=3 SV=3 1 344 9.0E-80
sp|P0CL89|XRN2_CRYNB 5'-3' exoribonuclease 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RAT1 PE=3 SV=1 1 387 1.0E-79
sp|P0CL88|XRN2_CRYNJ 5'-3' exoribonuclease 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RAT1 PE=3 SV=1 1 387 1.0E-79
sp|Q2UCP5|XRN2_ASPOR 5'-3' exoribonuclease 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rat1 PE=3 SV=3 1 348 2.0E-78
sp|Q9FQ04|XRN4_ARATH 5'-3' exoribonuclease 4 OS=Arabidopsis thaliana GN=XRN4 PE=2 SV=1 1 377 1.0E-77
sp|Q4P149|XRN2_USTMA 5'-3' exoribonuclease 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RAT1 PE=3 SV=3 1 344 5.0E-77
sp|Q2UCP5|XRN2_ASPOR 5'-3' exoribonuclease 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rat1 PE=3 SV=3 504 671 2.0E-48
sp|Q4P149|XRN2_USTMA 5'-3' exoribonuclease 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RAT1 PE=3 SV=3 499 742 1.0E-45
sp|Q02792|XRN2_YEAST 5'-3' exoribonuclease 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAT1 PE=1 SV=3 495 674 2.0E-44
sp|Q6FKN6|XRN2_CANGA 5'-3' exoribonuclease 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RAT1 PE=3 SV=3 486 684 3.0E-44
sp|P0CL89|XRN2_CRYNB 5'-3' exoribonuclease 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RAT1 PE=3 SV=1 499 676 4.0E-44
sp|P0CL88|XRN2_CRYNJ 5'-3' exoribonuclease 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RAT1 PE=3 SV=1 499 676 4.0E-44
sp|Q6CKX0|XRN2_KLULA 5'-3' exoribonuclease 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAT1 PE=3 SV=3 486 668 2.0E-41
sp|Q74ZA0|XRN2_ASHGO 5'-3' exoribonuclease 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RAT1 PE=3 SV=4 486 668 2.0E-40
sp|Q9FQ04|XRN4_ARATH 5'-3' exoribonuclease 4 OS=Arabidopsis thaliana GN=XRN4 PE=2 SV=1 505 668 2.0E-40
sp|Q9VM71|XRN2_DROME 5'-3' exoribonuclease 2 homolog OS=Drosophila melanogaster GN=Rat1 PE=1 SV=2 497 671 2.0E-39
sp|Q9QSK5|EXON_IIV6 Putative exonuclease 012L OS=Invertebrate iridescent virus 6 GN=IIV6-012L PE=3 SV=1 1 358 6.0E-30
sp|Q197A1|EX0N_IIV3 Putative exonuclease 059L OS=Invertebrate iridescent virus 3 GN=IIV3-059L PE=3 SV=1 1 311 4.0E-23
sp|Q197A1|EX0N_IIV3 Putative exonuclease 059L OS=Invertebrate iridescent virus 3 GN=IIV3-059L PE=3 SV=1 529 681 8.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0004527 exonuclease activity Yes
GO:0003676 nucleic acid binding Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0004518 nuclease activity No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0016788 hydrolase activity, acting on ester bonds No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4146
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2635
Ophiocordyceps australis map64 (Brazil) OphauB2|5531
Ophiocordyceps camponoti-floridani Ophcf2|00588
Ophiocordyceps camponoti-rufipedis Ophun1|7396 (this protein)
Ophiocordyceps kimflemingae Ophio5|7713
Ophiocordyceps subramaniannii Hirsu2|8404

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7396
MGVPKFFRWLSERYPAISQVIAENRIPEFDCLYLDMNGIIHNCTHKDAGEDATFRLSEEEMFIRIFNYIEHLFGK
IKPKQLFFMAIDGVAPRAKMNQQRARRFRTALDAEKAREKAIKEGVAMPKEEPFDRTVFMAKLSQQLRYFVNKKI
SEDTEWQGCEVVLSGHDVPGEGEHKIMEYIRNAKAQPGYNPNVRHCLYGLDADLIMLGLLSHDPHFCLLREEVTF
GRASKTKSKELEHQSFYLLHLCIVREYLEMEFEELQKDGVLSFAFDLERVIDDFILMAFFVGNDFLPNLPGLHIN
EGALANMFGVYKKVLPKCQGYINESGVINLDRLRSLLEELSKLELLSFENDISDEKWFASKQNGTRQVANKSQTT
ERGPQGNSVAMTSFQRDLWKRKIRPFVSTRSKQTLNLGTSLKAADRKFVQDLAESMNLEWSTKEDENGDRSLALA
FPSLPGEGDEDDDDDEGGLAAWRLIKRYDRAPVVDVTVDDAQKHYEKLYQDKYQAWKTKYYLQKFPEWPSEKYDE
EQTALCENYAEGLQWVLFYYYEGIASWPWFYGYHYAPLISDVVKGLGADFKFKKGQPFKPYEQLMGVLPDRSKSI
VPKVYHDLMTNPDSPIIDFYPRDFELDMNGKKMEWEAVVKIPFIDEKRLLTAMASRNELLSDDEKGRNGFGVPIK
FTFSSEVCFVYPSSLPGTFHEINPCRCVENIFELPDVVGLEYLSGLTSGALLNIQALAGFPTLHHLPHTAQLVEN
HRVNVFQADSKNPSLVVTLTDSDVRTRVEIWKAKLGQRCYVNYPFLQEAKVMRVQDELFSYTLAENGKDIITKNH
DPKEMEAFQKEADYLENWYGKRLAITIGRVECLVHVHMLKGLIKTDEGALIKVYAENSSVRSAYASQTVVDEVVN
EDERFIEKAALPIEEELPVETRAFFLGEYAYGRPLEIMGHANNKAEVVLSTLNTKEPSFAREVIQQAERTNPYTP
SFTVAKQLGMHPLVLSKITSSFQVTNLAGLKLNLGLNLKFEGKKLKVLGYSRKSRTGWEFSHLAIKLIADYMVAF
PDFFAAIQREQQNSDIVETDLWPDPKVASQRIKDIVAWLKTQETGKFERVTLEAEQLDSDIVMALAQVGEQLLEA
AGDTSIQKLRGVPRSAILKPVDAELVLGNQKFSLGDRVTFAAAAGKVPIATRGTVVGISRTATALLLDVVWDTSF
MSGTTLGERAPMFRGQTVSSTSVLNTTNRQVISASYKSQQRRSVPQGPKPAGMSQYTNGPVPPPLRGGWRGAAVA
GANRWADGNAPTLLHSTLVYRSSSSGEPSTGLRQGRGGHQANGRGERRGRGRGTVDDFRRAASAQAAAPKYGNVP
PPASLDGPRGGRGGWSRGGRGAGFSGRGRGRGGVNGDAKLDL*
Coding >Ophun1|7396
ATGGGTGTTCCCAAGTTCTTTCGATGGCTCTCGGAGCGCTATCCTGCCATCTCCCAAGTCATTGCGGAGAATCGG
ATCCCCGAATTCGACTGCCTCTATCTCGATATGAATGGAATCATCCATAACTGCACGCACAAGGATGCTGGCGAG
GATGCGACCTTTAGGCTCAGCGAGGAGGAAATGTTCATCCGCATCTTCAACTACATCGAGCACCTTTTCGGAAAG
ATAAAGCCCAAGCAACTCTTCTTCATGGCCATCGATGGCGTGGCGCCTCGAGCCAAGATGAATCAGCAGAGGGCG
CGCCGCTTTCGAACAGCTCTAGATGCCGAAAAGGCTCGCGAAAAGGCCATCAAGGAGGGCGTCGCGATGCCAAAG
GAAGAGCCCTTTGACAGAACTGTCTTCATGGCCAAGCTGTCGCAACAACTACGCTACTTCGTTAACAAGAAGATA
TCGGAAGATACCGAGTGGCAGGGCTGTGAAGTCGTATTGTCCGGCCACGACGTACCAGGTGAAGGAGAACATAAG
ATCATGGAGTACATCCGCAACGCAAAGGCACAACCCGGCTACAACCCCAATGTGCGGCACTGCCTCTACGGCTTG
GACGCCGATCTAATCATGCTGGGCTTGCTCAGTCACGATCCGCACTTTTGCCTCTTGCGAGAAGAGGTGACGTTC
GGGCGAGCCTCCAAGACCAAGTCTAAGGAGCTCGAGCACCAAAGTTTCTACCTTCTTCACCTCTGCATCGTCAGA
GAATACTTGGAAATGGAGTTTGAGGAGTTGCAAAAGGATGGTGTGCTGAGTTTCGCATTCGATCTCGAGCGGGTC
ATTGATGATTTCATCCTCATGGCGTTTTTTGTCGGCAACGACTTTCTTCCCAACCTCCCTGGCCTTCACATCAAC
GAAGGTGCTCTGGCAAACATGTTTGGCGTGTACAAAAAAGTTCTACCCAAGTGCCAGGGATACATCAACGAAAGC
GGCGTCATCAACTTGGATCGTCTGCGCAGCCTCCTCGAGGAACTAAGCAAGCTCGAGCTGCTTTCCTTCGAAAAC
GACATCTCGGATGAGAAGTGGTTCGCGTCGAAGCAGAACGGAACAAGGCAGGTGGCGAATAAGAGTCAGACGACA
GAAAGGGGCCCTCAGGGCAACTCTGTCGCCATGACGTCGTTCCAGCGGGATCTGTGGAAGCGAAAGATTCGACCC
TTCGTTTCCACTCGATCGAAACAAACGTTGAACCTCGGCACCAGTCTCAAGGCAGCAGACCGCAAGTTTGTCCAG
GATCTCGCTGAGTCGATGAACTTGGAGTGGTCAACCAAGGAGGATGAGAACGGCGACCGATCACTCGCACTGGCT
TTTCCATCGTTGCCTGGTGAGGGAGACGAAGATGATGATGATGATGAGGGCGGCCTGGCGGCCTGGCGTTTGATC
AAGCGCTACGACAGAGCTCCAGTCGTCGACGTGACGGTTGACGATGCGCAGAAGCACTATGAAAAGTTGTACCAG
GACAAATACCAGGCGTGGAAGACCAAGTACTACCTTCAGAAGTTTCCCGAATGGCCTTCGGAGAAATATGACGAG
GAGCAGACGGCGCTCTGCGAGAATTACGCTGAGGGCCTCCAGTGGGTTCTCTTTTACTACTACGAGGGTATAGCA
TCATGGCCATGGTTCTACGGCTATCACTATGCGCCGCTCATATCAGACGTCGTCAAGGGCCTCGGCGCCGACTTC
AAGTTCAAAAAGGGCCAGCCGTTCAAGCCCTATGAACAACTGATGGGAGTCTTACCCGATCGCAGCAAAAGCATC
GTTCCCAAGGTGTATCACGACCTGATGACCAACCCGGACTCGCCCATCATCGACTTTTATCCCCGAGACTTTGAG
CTCGACATGAACGGCAAGAAGATGGAATGGGAGGCCGTCGTCAAGATCCCCTTTATCGACGAGAAGCGTCTTCTG
ACCGCCATGGCTTCGCGGAACGAGCTTCTCAGCGACGACGAAAAGGGACGGAATGGGTTTGGGGTTCCCATCAAG
TTTACGTTTTCCTCGGAAGTGTGCTTCGTATACCCTTCATCTCTGCCGGGCACCTTTCACGAAATCAACCCCTGT
CGTTGCGTCGAAAACATCTTCGAGCTGCCCGACGTCGTGGGCCTCGAATACCTGTCCGGCCTGACGTCTGGCGCC
TTGCTCAACATTCAGGCACTGGCAGGGTTTCCCACGCTTCATCATCTACCGCACACGGCGCAGCTCGTCGAGAAT
CACAGAGTCAATGTCTTTCAGGCCGACAGCAAGAACCCCAGTCTCGTCGTCACCTTGACTGATAGCGACGTACGC
ACCAGAGTTGAAATTTGGAAGGCGAAGCTCGGCCAACGCTGTTACGTGAACTATCCTTTCCTGCAAGAAGCCAAG
GTTATGCGTGTCCAAGACGAGCTCTTCTCGTACACGCTGGCAGAAAACGGAAAGGATATCATCACGAAGAACCAT
GACCCGAAAGAGATGGAAGCTTTTCAGAAGGAAGCAGATTACCTGGAGAACTGGTATGGGAAGCGTTTGGCCATC
ACCATCGGCAGAGTAGAGTGCCTCGTCCACGTGCACATGCTCAAGGGCCTGATCAAGACGGATGAGGGGGCGCTG
ATCAAAGTCTACGCCGAAAACTCGAGTGTGCGAAGCGCATACGCATCACAGACGGTCGTCGATGAAGTCGTCAAC
GAGGATGAGCGCTTCATCGAAAAGGCCGCCCTGCCGATCGAGGAAGAACTTCCCGTGGAGACGCGAGCGTTCTTC
CTCGGCGAATACGCATACGGACGTCCCCTGGAGATCATGGGCCACGCCAACAACAAGGCGGAAGTTGTGCTCTCG
ACGCTCAACACCAAGGAGCCGTCGTTTGCAAGGGAAGTGATCCAGCAGGCGGAGCGGACGAATCCGTACACGCCT
TCATTTACTGTTGCCAAACAGCTGGGCATGCATCCTCTGGTGTTGAGCAAGATCACATCTTCGTTTCAAGTCACG
AATCTGGCCGGGCTGAAGCTGAACCTGGGCCTGAATCTCAAGTTCGAGGGCAAGAAGCTCAAGGTCTTGGGCTAC
TCTCGGAAGTCAAGGACGGGCTGGGAATTCAGTCACCTGGCCATCAAGCTGATCGCCGACTACATGGTCGCGTTC
CCGGACTTCTTCGCTGCGATCCAGAGGGAGCAGCAGAACTCGGACATTGTTGAGACGGACCTGTGGCCGGACCCG
AAGGTGGCTTCGCAGCGCATCAAGGACATTGTGGCCTGGCTGAAGACGCAGGAGACGGGCAAGTTTGAGAGGGTC
ACGCTGGAGGCCGAACAGCTCGACTCGGACATTGTCATGGCCCTTGCCCAGGTCGGCGAGCAGCTTCTAGAGGCT
GCCGGCGACACGTCGATCCAGAAGCTTCGCGGCGTGCCTCGGTCGGCCATTCTCAAGCCGGTAGATGCCGAGCTC
GTGCTGGGCAATCAGAAGTTCAGCCTCGGCGACCGAGTCACGTTCGCTGCGGCCGCGGGTAAAGTGCCCATCGCC
ACACGAGGAACGGTAGTGGGCATCAGTCGAACTGCGACGGCGCTGCTCCTGGATGTCGTCTGGGACACGTCGTTT
ATGAGCGGGACGACGCTGGGCGAGCGAGCACCCATGTTCAGGGGCCAGACGGTGTCGTCGACTTCGGTGCTCAAC
ACGACGAACAGGCAGGTCATCTCGGCCTCGTACAAGTCGCAACAGCGGCGCTCAGTTCCGCAGGGACCGAAGCCG
GCGGGCATGTCGCAGTATACGAACGGTCCGGTGCCGCCTCCGCTGCGAGGCGGGTGGCGCGGAGCGGCCGTCGCT
GGAGCCAACCGATGGGCCGATGGCAACGCCCCGACCTTGCTGCACAGCACGCTCGTGTATCGGAGCAGCTCCAGC
GGTGAGCCTTCGACGGGACTGAGACAGGGACGAGGGGGACACCAAGCCAACGGAAGAGGTGAGCGGCGAGGGCGT
GGCCGCGGAACCGTCGACGACTTCCGACGAGCTGCTTCTGCCCAGGCGGCCGCACCTAAATATGGAAACGTCCCT
CCGCCTGCCTCCCTGGACGGTCCTCGCGGTGGCCGTGGTGGCTGGAGCCGTGGCGGCCGAGGCGCTGGGTTTTCC
GGAAGAGGGCGCGGCCGAGGGGGCGTCAATGGCGATGCCAAGTTGGATCTATGA
Transcript >Ophun1|7396
ATGGGTGTTCCCAAGTTCTTTCGATGGCTCTCGGAGCGCTATCCTGCCATCTCCCAAGTCATTGCGGAGAATCGG
ATCCCCGAATTCGACTGCCTCTATCTCGATATGAATGGAATCATCCATAACTGCACGCACAAGGATGCTGGCGAG
GATGCGACCTTTAGGCTCAGCGAGGAGGAAATGTTCATCCGCATCTTCAACTACATCGAGCACCTTTTCGGAAAG
ATAAAGCCCAAGCAACTCTTCTTCATGGCCATCGATGGCGTGGCGCCTCGAGCCAAGATGAATCAGCAGAGGGCG
CGCCGCTTTCGAACAGCTCTAGATGCCGAAAAGGCTCGCGAAAAGGCCATCAAGGAGGGCGTCGCGATGCCAAAG
GAAGAGCCCTTTGACAGAACTGTCTTCATGGCCAAGCTGTCGCAACAACTACGCTACTTCGTTAACAAGAAGATA
TCGGAAGATACCGAGTGGCAGGGCTGTGAAGTCGTATTGTCCGGCCACGACGTACCAGGTGAAGGAGAACATAAG
ATCATGGAGTACATCCGCAACGCAAAGGCACAACCCGGCTACAACCCCAATGTGCGGCACTGCCTCTACGGCTTG
GACGCCGATCTAATCATGCTGGGCTTGCTCAGTCACGATCCGCACTTTTGCCTCTTGCGAGAAGAGGTGACGTTC
GGGCGAGCCTCCAAGACCAAGTCTAAGGAGCTCGAGCACCAAAGTTTCTACCTTCTTCACCTCTGCATCGTCAGA
GAATACTTGGAAATGGAGTTTGAGGAGTTGCAAAAGGATGGTGTGCTGAGTTTCGCATTCGATCTCGAGCGGGTC
ATTGATGATTTCATCCTCATGGCGTTTTTTGTCGGCAACGACTTTCTTCCCAACCTCCCTGGCCTTCACATCAAC
GAAGGTGCTCTGGCAAACATGTTTGGCGTGTACAAAAAAGTTCTACCCAAGTGCCAGGGATACATCAACGAAAGC
GGCGTCATCAACTTGGATCGTCTGCGCAGCCTCCTCGAGGAACTAAGCAAGCTCGAGCTGCTTTCCTTCGAAAAC
GACATCTCGGATGAGAAGTGGTTCGCGTCGAAGCAGAACGGAACAAGGCAGGTGGCGAATAAGAGTCAGACGACA
GAAAGGGGCCCTCAGGGCAACTCTGTCGCCATGACGTCGTTCCAGCGGGATCTGTGGAAGCGAAAGATTCGACCC
TTCGTTTCCACTCGATCGAAACAAACGTTGAACCTCGGCACCAGTCTCAAGGCAGCAGACCGCAAGTTTGTCCAG
GATCTCGCTGAGTCGATGAACTTGGAGTGGTCAACCAAGGAGGATGAGAACGGCGACCGATCACTCGCACTGGCT
TTTCCATCGTTGCCTGGTGAGGGAGACGAAGATGATGATGATGATGAGGGCGGCCTGGCGGCCTGGCGTTTGATC
AAGCGCTACGACAGAGCTCCAGTCGTCGACGTGACGGTTGACGATGCGCAGAAGCACTATGAAAAGTTGTACCAG
GACAAATACCAGGCGTGGAAGACCAAGTACTACCTTCAGAAGTTTCCCGAATGGCCTTCGGAGAAATATGACGAG
GAGCAGACGGCGCTCTGCGAGAATTACGCTGAGGGCCTCCAGTGGGTTCTCTTTTACTACTACGAGGGTATAGCA
TCATGGCCATGGTTCTACGGCTATCACTATGCGCCGCTCATATCAGACGTCGTCAAGGGCCTCGGCGCCGACTTC
AAGTTCAAAAAGGGCCAGCCGTTCAAGCCCTATGAACAACTGATGGGAGTCTTACCCGATCGCAGCAAAAGCATC
GTTCCCAAGGTGTATCACGACCTGATGACCAACCCGGACTCGCCCATCATCGACTTTTATCCCCGAGACTTTGAG
CTCGACATGAACGGCAAGAAGATGGAATGGGAGGCCGTCGTCAAGATCCCCTTTATCGACGAGAAGCGTCTTCTG
ACCGCCATGGCTTCGCGGAACGAGCTTCTCAGCGACGACGAAAAGGGACGGAATGGGTTTGGGGTTCCCATCAAG
TTTACGTTTTCCTCGGAAGTGTGCTTCGTATACCCTTCATCTCTGCCGGGCACCTTTCACGAAATCAACCCCTGT
CGTTGCGTCGAAAACATCTTCGAGCTGCCCGACGTCGTGGGCCTCGAATACCTGTCCGGCCTGACGTCTGGCGCC
TTGCTCAACATTCAGGCACTGGCAGGGTTTCCCACGCTTCATCATCTACCGCACACGGCGCAGCTCGTCGAGAAT
CACAGAGTCAATGTCTTTCAGGCCGACAGCAAGAACCCCAGTCTCGTCGTCACCTTGACTGATAGCGACGTACGC
ACCAGAGTTGAAATTTGGAAGGCGAAGCTCGGCCAACGCTGTTACGTGAACTATCCTTTCCTGCAAGAAGCCAAG
GTTATGCGTGTCCAAGACGAGCTCTTCTCGTACACGCTGGCAGAAAACGGAAAGGATATCATCACGAAGAACCAT
GACCCGAAAGAGATGGAAGCTTTTCAGAAGGAAGCAGATTACCTGGAGAACTGGTATGGGAAGCGTTTGGCCATC
ACCATCGGCAGAGTAGAGTGCCTCGTCCACGTGCACATGCTCAAGGGCCTGATCAAGACGGATGAGGGGGCGCTG
ATCAAAGTCTACGCCGAAAACTCGAGTGTGCGAAGCGCATACGCATCACAGACGGTCGTCGATGAAGTCGTCAAC
GAGGATGAGCGCTTCATCGAAAAGGCCGCCCTGCCGATCGAGGAAGAACTTCCCGTGGAGACGCGAGCGTTCTTC
CTCGGCGAATACGCATACGGACGTCCCCTGGAGATCATGGGCCACGCCAACAACAAGGCGGAAGTTGTGCTCTCG
ACGCTCAACACCAAGGAGCCGTCGTTTGCAAGGGAAGTGATCCAGCAGGCGGAGCGGACGAATCCGTACACGCCT
TCATTTACTGTTGCCAAACAGCTGGGCATGCATCCTCTGGTGTTGAGCAAGATCACATCTTCGTTTCAAGTCACG
AATCTGGCCGGGCTGAAGCTGAACCTGGGCCTGAATCTCAAGTTCGAGGGCAAGAAGCTCAAGGTCTTGGGCTAC
TCTCGGAAGTCAAGGACGGGCTGGGAATTCAGTCACCTGGCCATCAAGCTGATCGCCGACTACATGGTCGCGTTC
CCGGACTTCTTCGCTGCGATCCAGAGGGAGCAGCAGAACTCGGACATTGTTGAGACGGACCTGTGGCCGGACCCG
AAGGTGGCTTCGCAGCGCATCAAGGACATTGTGGCCTGGCTGAAGACGCAGGAGACGGGCAAGTTTGAGAGGGTC
ACGCTGGAGGCCGAACAGCTCGACTCGGACATTGTCATGGCCCTTGCCCAGGTCGGCGAGCAGCTTCTAGAGGCT
GCCGGCGACACGTCGATCCAGAAGCTTCGCGGCGTGCCTCGGTCGGCCATTCTCAAGCCGGTAGATGCCGAGCTC
GTGCTGGGCAATCAGAAGTTCAGCCTCGGCGACCGAGTCACGTTCGCTGCGGCCGCGGGTAAAGTGCCCATCGCC
ACACGAGGAACGGTAGTGGGCATCAGTCGAACTGCGACGGCGCTGCTCCTGGATGTCGTCTGGGACACGTCGTTT
ATGAGCGGGACGACGCTGGGCGAGCGAGCACCCATGTTCAGGGGCCAGACGGTGTCGTCGACTTCGGTGCTCAAC
ACGACGAACAGGCAGGTCATCTCGGCCTCGTACAAGTCGCAACAGCGGCGCTCAGTTCCGCAGGGACCGAAGCCG
GCGGGCATGTCGCAGTATACGAACGGTCCGGTGCCGCCTCCGCTGCGAGGCGGGTGGCGCGGAGCGGCCGTCGCT
GGAGCCAACCGATGGGCCGATGGCAACGCCCCGACCTTGCTGCACAGCACGCTCGTGTATCGGAGCAGCTCCAGC
GGTGAGCCTTCGACGGGACTGAGACAGGGACGAGGGGGACACCAAGCCAACGGAAGAGGTGAGCGGCGAGGGCGT
GGCCGCGGAACCGTCGACGACTTCCGACGAGCTGCTTCTGCCCAGGCGGCCGCACCTAAATATGGAAACGTCCCT
CCGCCTGCCTCCCTGGACGGTCCTCGCGGTGGCCGTGGTGGCTGGAGCCGTGGCGGCCGAGGCGCTGGGTTTTCC
GGAAGAGGGCGCGGCCGAGGGGGCGTCAATGGCGATGCCAAGTTGGATCTATGA
Gene >Ophun1|7396
ATGGGGTACGATGTCCTCTCGCACCTTTCGCTTGTTCAAAGGCTTATCCCCATCACAGTGTTCCCAAGTTCTTTC
GATGGCTCTCGGAGCGCTATCCTGCCATCTCCCAAGTCATTGCGGAGAATCGGATCCCCGAATTCGACTGCCTCT
ATGTGAATCCCACCCCCTTTCCACCGTTGGCCGCCCACTGACTTGGTCGTGCAGCTCGATATGAATGGAATCATC
CATAACTGCACGCACAAGGATGCTGGCGAGGATGCGACCTTTAGGCTCAGCGAGGAGGAAATGTTCATCCGCATC
TTCAACTACATCGAGCACCTTTTCGGAAAGATAAAGCCCAAGCAACTCTTCTTCATGGCCATCGATGGCGTGGCG
CCTCGAGCCAAGATGAATCAGCAGAGGGCGCGCCGCTTTCGAACAGCTCTAGATGCCGAAAAGGCTCGCGAAAAG
GCCATCAAGGAGGGCGTCGCGATGCCAAAGGAAGAGCCCTTTGACAGTAATTGCATCACGCCAGGCAAGTTGACG
GCATCCGTCTATCGAGAACGCGGCACACGCTGACCGTCTTCTCAAGGAACTGTCTTCATGGCCAAGCTGTCGCAA
CAACTACGCTACTTCGTTAACAAGAAGATATCGGAAGATACCGAGTGGCAGGGCTGTGAAGTCGTATTGTCCGGC
CACGACGTACCAGGTGAAGGAGAACATAAGATCATGGAGTACATCCGCAACGCAAAGGCACAACCCGGCTACAAC
CCCAATGTGCGGCACTGCCTCTACGGCTTGGACGCCGATCTAATCATGCTGGGCTTGCTCAGTCACGATCCGCAC
TTTTGCCTCTTGCGAGAAGAGGTGACGTTCGGGCGAGCCTCCAAGACCAAGTCTAAGGAGCTCGAGCACCAAAGT
TTCTACCTTCTTCACCTCTGCATCGTCAGAGAATACTTGGAAATGGAGTTTGAGGAGTTGCAAAAGGATGGTGTG
CTGAGTTTCGCATTCGATCTCGAGCGGGTCATTGATGATTTCATCCTCATGGCGTTTTTTGTCGGCAACGACTTT
CTTCCCAACCTCCCTGGCCTTCACATCAACGAAGGTGCTCTGGCAAACATGTTTGGCGTGTACAAAAAAGTTCTA
CCCAAGTGCCAGGGATACATCAACGAAAGCGGCGTCATCAACTTGGATCGTCTGCGCAGCCTCCTCGAGGAACTA
AGCAAGCTCGAGCTGCTTTCCTTCGAAAACGACATCTCGGATGAGAAGTGGTTCGCGTCGAAGCAGAACGGAACA
AGGCAGGTGGCGAATAAGAGTCAGACGACAGAAAGGGGCCCTCAGGGCAACTCTGTCGCCATGACGTCGTTCCAG
CGGGATCTGTGGAAGCGAAAGATTCGACCCTTCGTTTCCACTCGATCGAAACAAACGTTGAACCTCGGCACCAGT
CTCAAGGCAGCAGACCGCAAGTTTGTCCAGGATCTCGCTGAGTCGATGAACTTGGAGTGGTCAACCAAGGAGGAT
GAGAACGGCGACCGATCACTCGCACTGGCTTTTCCATCGTTGCCTGGTGAGGGAGACGAAGATGATGATGATGAT
GAGGGCGGCCTGGCGGCCTGGCGTTTGATCAAGCGCTACGACAGAGCTCCAGTCGTCGACGTGACGGTTGACGAT
GCGCAGAAGCACTATGAAAAGTTGTACCAGGACAAATACCAGGCGTGGAAGACCAAGTACTACCTTCAGAAGTTT
CCCGAATGGCCTTCGGAGAAATATGACGAGGAGCAGACGGCGCTCTGCGAGAATTACGCTGAGGGCCTCCAGTGG
GTTCTCTTTTACTACTACGAGGGTATAGCATCATGGCCATGGTTCTACGGCTATCACTATGCGCCGCTCATATCA
GGTTCGTCAGCCTCGAGCTGTTCCATCGTTGCAGACTAACAATTGTTCCTCAGACGTCGTCAAGGGCCTCGGCGC
CGACTTCAAGTTCAAAAAGGGCCAGCCGTTCAAGCCCTATGAACAACTGATGGGAGTCTTACCCGATCGCAGCAA
AAGCATCGTTCCCAAGGTGTATCACGACCTGATGACCAACCCGGACTCGCCCATCATCGACTTTTATCCCCGAGA
CTTTGAGCTCGACATGAACGGCAAGAAGATGGAATGGGAGGCCGTCGTCAAGATCCCCTTTATCGACGAGAAGCG
TCTTCTGACCGCCATGGCTTCGCGGAACGAGCTTCTCAGCGACGACGAAAAGGGACGGAATGGGTTTGGGGTTCC
CATCAAGTTTACGTTTTCCTCGGAAGTGTGCTTCGTATACCCTTCATCTCTGCCGGGCACCTTTCACGAAATCAA
CCCCTGTCGTTGCGTCGAAAACATCTTCGAGCTGCCCGACGTCGTGGGCCTCGAATACCTGTCCGGCCTGACGTC
TGGCGCCTTGCTCAACATTCAGGCACTGGCAGGGTTTCCCACGCTTCATCATCTACCGCACACGGCGCAGCTCGT
CGAGAATCACAGAGTCAATGTCTTTCAGGCCGACAGCAAGAACCCCAGTCTCGTCGTCACCTTGACTGATAGCGA
CGTACGCACCAGAGTTGAAATTTGGAAGGCGAAGCTCGGCCAACGCTGTTACGTGAACTATCCTTTCCTGCAAGA
AGCCAAGGTTATGCGTGTCCAAGACGAGCTCTTCTCGTACACGCTGGCAGAAAACGGAAAGGATATCATCACGAA
GAACCATGACCCGAAAGAGATGGAAGCTTTTCAGAAGGAAGCAGATTACCTGGAGAACTGGTATGGGAAGCGTTT
GGCCATCACCATCGGCAGAGTAGAGTGCCTCGTCCACGTGCACATGCTCAAGGGCCTGATCAAGACGGATGAGGG
GGCGCTGATCAAAGTCTACGCCGAAAACTCGAGTGTGCGAAGCGCATACGCATCACAGACGGTCGTCGATGAAGT
CGTCAACGAGGATGAGCGCTTCATCGAAAAGGCCGCCCTGCCGATCGAGGAAGAACTTCCCGTGGAGACGCGAGC
GTTCTTCCTCGGCGAATACGCATACGGACGTCCCCTGGAGATCATGGGCCACGCCAACAACAAGGCGGAAGTTGT
GCTCTCGACGCTCAACACCAAGGAGCCGTCGTTTGCAAGGGAAGTGATCCAGCAGGCGGAGCGGACGAATCCGTA
CACGCCTTCATTTACTGTTGCCAAACAGCTGGGCATGCATCCTCTGGTGTTGAGCAAGATCACATCTTCGTTTCA
AGTCACGAATCTGGCCGGGCTGAAGCTGAACCTGGGCCTGAATCTCAAGTTCGAGGGCAAGAAGCTCAAGGTCTT
GGGCTACTCTCGGAAGTCAAGGACGGGCTGGGAATTCAGTCACCTGGCCATCAAGCTGATCGCCGACTACATGGT
CGCGTTCCCGGACTTCTTCGCTGCGATCCAGAGGGAGCAGCAGAACTCGGACATTGTTGAGACGGACCTGTGGCC
GGACCCGAAGGTGGCTTCGCAGCGCATCAAGGACATTGTGGCCTGGCTGAAGACGCAGGAGACGGGCAAGTTTGA
GAGGGTCACGCTGGAGGCCGAACAGCTCGACTCGGACATTGTCATGGCCCTTGCCCAGGTCGGCGAGCAGCTTCT
AGAGGCTGCCGGCGACACGTCGATCCAGAAGCTTCGCGGCGTGCCTCGGTCGGCCATTCTCAAGCCGGTAGATGC
CGAGCTCGTGCTGGGCAATCAGAAGTTCAGCCTCGGCGACCGAGTCACGTTCGCTGCGGCCGCGGGTAAAGTGCC
CATCGCCACACGAGGAACGGTAGTGGGCATCAGTCGAACTGCGACGGCGCTGCTCCTGGATGTCGTCTGGGACAC
GTCGTTTATGAGCGGGACGACGCTGGGCGAGCGAGCACCCATGTTCAGGGGCCAGACGGTGTCGTCGACTTCGGT
GCTCAACACGACGAACAGGCAGGTCATCTCGGCCTCGTACAAGTCGCAACAGCGGCGCTCAGTTCCGCAGGGACC
GAAGCCGGCGGGCATGTCGCAGTATACGAACGGTCCGGTGCCGCCTCCGCTGCGAGGCGGGTGGCGCGGAGCGGC
CGTCGCTGGAGCCAACCGATGGGCCGATGGCAACGCCCCGACCTTGCTGCACAGCACGCTCGTGTATCGGAGCAG
CTCCAGCGGTGAGCCTTCGACGGGACTGAGACAGGGACGAGGGGGACACCAAGCCAACGGAAGAGGTGAGCGGCG
AGGGCGTGGCCGCGGAACCGTCGACGACTTCCGACGAGCTGCTTCTGCCCAGGCGGCCGCACCTAAATATGGAAA
CGTCCCTCCGCCTGCCTCCCTGGACGGTCCTCGCGGTGGCCGTGGTGGCTGGAGCCGTGGCGGCCGAGGCGCTGG
GTTTTCCGGAAGAGGGCGCGGCCGAGGGGGCGTCAATGGCGATGCCAAGTTGGATCTATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail