Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|739
Gene name
LocationContig_1249:1701..3206
Strand+
Gene length (bp)1505
Transcript length (bp)1461
Coding sequence length (bp)1461
Protein length (aa) 487

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01416 PseudoU_synth_1 tRNA pseudouridine synthase 6.2E-31 264 387

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q3SX07|PUS3_BOVIN tRNA pseudouridine(38/39) synthase OS=Bos taurus GN=PUS3 PE=2 SV=1 33 432 4.0E-79
sp|P31115|PUS3_YEAST tRNA pseudouridine(38/39) synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DEG1 PE=1 SV=1 13 390 7.0E-77
sp|Q9JI38|PUS3_MOUSE tRNA pseudouridine(38/39) synthase OS=Mus musculus GN=Pus3 PE=1 SV=2 75 432 3.0E-75
sp|Q9BZE2|PUS3_HUMAN tRNA pseudouridine(38/39) synthase OS=Homo sapiens GN=PUS3 PE=1 SV=3 33 432 7.0E-74
sp|Q9UTB3|YL85_SCHPO Putative tRNA pseudouridine synthase C25B8.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25B8.05 PE=3 SV=1 33 390 1.0E-63
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q3SX07|PUS3_BOVIN tRNA pseudouridine(38/39) synthase OS=Bos taurus GN=PUS3 PE=2 SV=1 33 432 4.0E-79
sp|P31115|PUS3_YEAST tRNA pseudouridine(38/39) synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DEG1 PE=1 SV=1 13 390 7.0E-77
sp|Q9JI38|PUS3_MOUSE tRNA pseudouridine(38/39) synthase OS=Mus musculus GN=Pus3 PE=1 SV=2 75 432 3.0E-75
sp|Q9BZE2|PUS3_HUMAN tRNA pseudouridine(38/39) synthase OS=Homo sapiens GN=PUS3 PE=1 SV=3 33 432 7.0E-74
sp|Q9UTB3|YL85_SCHPO Putative tRNA pseudouridine synthase C25B8.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25B8.05 PE=3 SV=1 33 390 1.0E-63
sp|Q09524|TG124_CAEEL Probable tRNA pseudouridine synthase tag-124 OS=Caenorhabditis elegans GN=tag-124 PE=3 SV=1 72 386 1.0E-45
sp|A0B7V0|TRUA_METTP tRNA pseudouridine synthase A OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=truA PE=3 SV=1 90 390 2.0E-27
sp|Q8TU65|TRUA_METAC tRNA pseudouridine synthase A OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=truA PE=3 SV=1 90 361 1.0E-22
sp|Q8PWT1|TRUA_METMA tRNA pseudouridine synthase A OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=truA PE=3 SV=1 90 363 3.0E-22
sp|O26928|TRUA_METTH tRNA pseudouridine synthase A OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=truA PE=3 SV=1 88 363 1.0E-21
sp|Q12VJ7|TRUA_METBU tRNA pseudouridine synthase A OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=truA PE=3 SV=1 90 387 1.0E-20
sp|Q46CU8|TRUA_METBF tRNA pseudouridine synthase A OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=truA PE=3 SV=1 90 361 1.0E-20
sp|Q2NHB4|TRUA_METST tRNA pseudouridine synthase A OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=truA PE=3 SV=1 88 410 2.0E-19
sp|A3CXX4|TRUA_METMJ tRNA pseudouridine synthase A OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=truA PE=3 SV=1 90 386 4.0E-19
sp|C4KZL4|TRUA_EXISA tRNA pseudouridine synthase A OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=truA PE=3 SV=1 88 393 8.0E-19
sp|Q7NUD6|TRUA_CHRVO tRNA pseudouridine synthase A OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=truA PE=3 SV=1 90 388 3.0E-18
sp|B6YTJ2|TRUA_THEON tRNA pseudouridine synthase A OS=Thermococcus onnurineus (strain NA1) GN=truA PE=3 SV=1 90 390 3.0E-18
sp|B8GFU5|TRUA_METPE tRNA pseudouridine synthase A OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=truA PE=3 SV=1 90 383 6.0E-18
sp|Q5JI92|TRUA_THEKO tRNA pseudouridine synthase A OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=truA PE=3 SV=1 90 389 3.0E-17
sp|Q8U2C1|TRUA_PYRFU tRNA pseudouridine synthase A OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=truA PE=3 SV=1 90 402 4.0E-17
sp|Q7U376|TRUA_BORPA tRNA pseudouridine synthase A OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=truA PE=3 SV=1 90 405 5.0E-17
sp|Q7U386|TRUA_BORBR tRNA pseudouridine synthase A OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=truA PE=3 SV=1 90 405 5.0E-17
sp|B2SGK2|TRUA_FRATM tRNA pseudouridine synthase A OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=truA PE=3 SV=1 92 362 6.0E-17
sp|C5A7E9|TRUA_THEGJ tRNA pseudouridine synthase A OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=truA PE=3 SV=1 90 400 7.0E-17
sp|Q8XXX8|TRUA_RALSO tRNA pseudouridine synthase A OS=Ralstonia solanacearum (strain GMI1000) GN=truA PE=3 SV=1 90 394 7.0E-17
sp|Q2RFT1|TRUA_MOOTA tRNA pseudouridine synthase A OS=Moorella thermoacetica (strain ATCC 39073) GN=truA PE=3 SV=1 90 360 8.0E-17
sp|A2SHS6|TRUA_METPP tRNA pseudouridine synthase A OS=Methylibium petroleiphilum (strain PM1) GN=truA PE=3 SV=1 90 360 1.0E-16
sp|B1YH83|TRUA_EXIS2 tRNA pseudouridine synthase A OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=truA PE=3 SV=1 94 391 1.0E-16
sp|Q5NG36|TRUA_FRATT tRNA pseudouridine synthase A OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=truA PE=3 SV=1 92 361 2.0E-16
sp|Q14HI8|TRUA_FRAT1 tRNA pseudouridine synthase A OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=truA PE=3 SV=1 92 361 2.0E-16
sp|A4SWX4|TRUA_POLSQ tRNA pseudouridine synthase A OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=truA PE=3 SV=1 90 388 3.0E-16
sp|O28544|TRUA_ARCFU tRNA pseudouridine synthase A OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=truA PE=3 SV=1 90 437 3.0E-16
sp|B2U6Z1|TRUA_RALPJ tRNA pseudouridine synthase A OS=Ralstonia pickettii (strain 12J) GN=truA PE=3 SV=1 90 388 3.0E-16
sp|A4IXW8|TRUA_FRATW tRNA pseudouridine synthase A OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=truA PE=3 SV=1 92 361 1.0E-15
sp|A9IRL0|TRUA_BORPD tRNA pseudouridine synthase A OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=truA PE=3 SV=1 90 393 1.0E-15
sp|A0Q6C2|TRUA_FRATN tRNA pseudouridine synthase A OS=Francisella tularensis subsp. novicida (strain U112) GN=truA PE=3 SV=1 92 361 2.0E-15
sp|O87016|TRUA_PSEAE tRNA pseudouridine synthase A OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=truA PE=3 SV=1 90 353 2.0E-15
sp|O58941|TRUA_PYRHO tRNA pseudouridine synthase A OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=truA PE=3 SV=1 90 349 2.0E-15
sp|Q0W2P8|TRUA_METAR tRNA pseudouridine synthase A OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=truA PE=3 SV=1 91 361 2.0E-15
sp|C6A238|TRUA_THESM tRNA pseudouridine synthase A OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=truA PE=3 SV=1 90 396 3.0E-15
sp|A4J151|TRUA_DESRM tRNA pseudouridine synthase A OS=Desulfotomaculum reducens (strain MI-1) GN=truA PE=3 SV=1 90 361 3.0E-15
sp|Q2KYM0|TRUA_BORA1 tRNA pseudouridine synthase A OS=Bordetella avium (strain 197N) GN=truA PE=3 SV=1 90 360 4.0E-15
sp|B8I814|TRUA_CLOCE tRNA pseudouridine synthase A OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=truA PE=3 SV=1 88 369 4.0E-15
sp|Q9Z9J0|TRUA_BACHD tRNA pseudouridine synthase A OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=truA PE=3 SV=1 90 360 5.0E-15
sp|Q5L3Q7|TRUA_GEOKA tRNA pseudouridine synthase A OS=Geobacillus kaustophilus (strain HTA426) GN=truA PE=3 SV=1 87 388 7.0E-15
sp|B1MVY3|TRUA_LEUCK tRNA pseudouridine synthase A OS=Leuconostoc citreum (strain KM20) GN=truA PE=3 SV=1 87 362 7.0E-15
sp|A7NCA0|TRUA_FRATF tRNA pseudouridine synthase A OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=truA PE=3 SV=1 92 361 7.0E-15
sp|Q0BLV1|TRUA_FRATO tRNA pseudouridine synthase A OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=truA PE=3 SV=1 92 361 8.0E-15
sp|Q2A3D7|TRUA_FRATH tRNA pseudouridine synthase A OS=Francisella tularensis subsp. holarctica (strain LVS) GN=truA PE=3 SV=1 92 361 8.0E-15
sp|A2SU30|TRUA_METLZ tRNA pseudouridine synthase A OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=truA PE=3 SV=1 92 384 2.0E-14
sp|Q0AGX7|TRUA_NITEC tRNA pseudouridine synthase A OS=Nitrosomonas eutropha (strain C91) GN=truA PE=3 SV=1 90 371 3.0E-14
sp|B3EIU9|TRUA_CHLL2 tRNA pseudouridine synthase A OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=truA PE=3 SV=1 88 386 4.0E-14
sp|A9BNH5|TRUA_DELAS tRNA pseudouridine synthase A OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=truA PE=3 SV=1 90 362 6.0E-14
sp|C6E4S9|TRUA_GEOSM tRNA pseudouridine synthase A OS=Geobacter sp. (strain M21) GN=truA PE=3 SV=1 88 360 9.0E-14
sp|P60350|TRUA_GEOSL tRNA pseudouridine synthase A OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=truA PE=3 SV=1 88 370 1.0E-13
sp|Q8CXP1|TRUA_OCEIH tRNA pseudouridine synthase A OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=truA PE=3 SV=1 94 388 1.0E-13
sp|A1TLH0|TRUA_ACIAC tRNA pseudouridine synthase A OS=Acidovorax citrulli (strain AAC00-1) GN=truA PE=3 SV=1 90 349 1.0E-13
sp|A8F9B7|TRUA_BACP2 tRNA pseudouridine synthase A OS=Bacillus pumilus (strain SAFR-032) GN=truA PE=3 SV=1 90 388 2.0E-13
sp|Q1H0L9|TRUA_METFK tRNA pseudouridine synthase A OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=truA PE=3 SV=1 90 369 2.0E-13
sp|B7GJ99|TRUA_ANOFW tRNA pseudouridine synthase A OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=truA PE=3 SV=1 88 388 3.0E-13
sp|Q814C2|TRUA1_BACCR tRNA pseudouridine synthase A 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=truA1 PE=3 SV=2 90 388 3.0E-13
sp|B9LJG1|TRUA_CHLSY tRNA pseudouridine synthase A OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=truA PE=3 SV=1 88 349 4.0E-13
sp|A9WH95|TRUA_CHLAA tRNA pseudouridine synthase A OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=truA PE=3 SV=1 88 349 4.0E-13
sp|A8Z326|TRUA_STAAT tRNA pseudouridine synthase A OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=truA PE=3 SV=1 90 361 5.0E-13
sp|A6QJ61|TRUA_STAAE tRNA pseudouridine synthase A OS=Staphylococcus aureus (strain Newman) GN=truA PE=3 SV=1 90 361 5.0E-13
sp|Q5HDY9|TRUA_STAAC tRNA pseudouridine synthase A OS=Staphylococcus aureus (strain COL) GN=truA PE=3 SV=1 90 361 5.0E-13
sp|Q2FW37|TRUA_STAA8 tRNA pseudouridine synthase A OS=Staphylococcus aureus (strain NCTC 8325) GN=truA PE=3 SV=1 90 361 5.0E-13
sp|Q2FES0|TRUA_STAA3 tRNA pseudouridine synthase A OS=Staphylococcus aureus (strain USA300) GN=truA PE=3 SV=1 90 361 5.0E-13
sp|Q47HQ7|TRUA_DECAR tRNA pseudouridine synthase A OS=Dechloromonas aromatica (strain RCB) GN=truA PE=3 SV=1 90 371 6.0E-13
sp|Q8NVB7|TRUA_STAAW tRNA pseudouridine synthase A OS=Staphylococcus aureus (strain MW2) GN=truA PE=3 SV=1 90 361 8.0E-13
sp|Q6G7A2|TRUA_STAAS tRNA pseudouridine synthase A OS=Staphylococcus aureus (strain MSSA476) GN=truA PE=3 SV=1 90 361 8.0E-13
sp|B9MDL6|TRUA_ACIET tRNA pseudouridine synthase A OS=Acidovorax ebreus (strain TPSY) GN=truA PE=3 SV=1 90 361 9.0E-13
sp|P65849|TRUA_STAAN tRNA pseudouridine synthase A OS=Staphylococcus aureus (strain N315) GN=truA PE=3 SV=1 90 361 1.0E-12
sp|P65848|TRUA_STAAM tRNA pseudouridine synthase A OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=truA PE=3 SV=1 90 361 1.0E-12
sp|A5IV03|TRUA_STAA9 tRNA pseudouridine synthase A OS=Staphylococcus aureus (strain JH9) GN=truA PE=3 SV=1 90 361 1.0E-12
sp|A6U3U4|TRUA_STAA2 tRNA pseudouridine synthase A OS=Staphylococcus aureus (strain JH1) GN=truA PE=3 SV=1 90 361 1.0E-12
sp|A7X5B5|TRUA_STAA1 tRNA pseudouridine synthase A OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=truA PE=3 SV=1 90 361 1.0E-12
sp|P70973|TRUA_BACSU tRNA pseudouridine synthase A OS=Bacillus subtilis (strain 168) GN=truA PE=3 SV=2 94 361 1.0E-12
sp|B8DB42|TRUA_LISMH tRNA pseudouridine synthase A OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=truA PE=3 SV=1 87 360 1.0E-12
sp|A7Z0S0|TRUA_BACMF tRNA pseudouridine synthase A OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=truA PE=3 SV=1 90 361 1.0E-12
sp|Q126M3|TRUA_POLSJ tRNA pseudouridine synthase A OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=truA PE=3 SV=1 90 365 1.0E-12
sp|Q8XHV5|TRUA2_CLOPE tRNA pseudouridine synthase A 2 OS=Clostridium perfringens (strain 13 / Type A) GN=truA2 PE=3 SV=1 88 361 1.0E-12
sp|Q31HH6|TRUA_THICR tRNA pseudouridine synthase A OS=Thiomicrospira crunogena (strain XCL-2) GN=truA PE=3 SV=1 90 360 2.0E-12
sp|Q927P1|TRUA_LISIN tRNA pseudouridine synthase A OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=truA PE=3 SV=1 87 360 2.0E-12
sp|A8FTU0|TRUA_SHESH tRNA pseudouridine synthase A OS=Shewanella sediminis (strain HAW-EB3) GN=truA PE=3 SV=1 90 392 2.0E-12
sp|Q7M7J4|TRUA_VIBVY tRNA pseudouridine synthase A OS=Vibrio vulnificus (strain YJ016) GN=truA PE=3 SV=1 90 388 2.0E-12
sp|Q8CWK3|TRUA_VIBVU tRNA pseudouridine synthase A OS=Vibrio vulnificus (strain CMCP6) GN=truA PE=3 SV=1 90 388 2.0E-12
sp|Q7U363|TRUA_BORPE tRNA pseudouridine synthase A OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=truA PE=3 SV=1 90 405 2.0E-12
sp|Q6GEL6|TRUA_STAAR tRNA pseudouridine synthase A OS=Staphylococcus aureus (strain MRSA252) GN=truA PE=3 SV=1 90 361 2.0E-12
sp|Q5WLN0|TRUA_BACSK tRNA pseudouridine synthase A OS=Bacillus clausii (strain KSM-K16) GN=truA PE=3 SV=1 90 349 2.0E-12
sp|Q49ZD7|TRUA_STAS1 tRNA pseudouridine synthase A OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=truA PE=3 SV=1 90 361 2.0E-12
sp|Q2YYM7|TRUA_STAAB tRNA pseudouridine synthase A OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=truA PE=3 SV=1 90 361 3.0E-12
sp|A6T009|TRUA_JANMA tRNA pseudouridine synthase A OS=Janthinobacterium sp. (strain Marseille) GN=truA PE=3 SV=1 87 372 3.0E-12
sp|Q8NSV0|TRUA_CORGL tRNA pseudouridine synthase A OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=truA PE=3 SV=1 90 392 3.0E-12
sp|Q3KLN5|TRUA_CHLTA tRNA pseudouridine synthase A OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=truA PE=3 SV=1 87 365 3.0E-12
sp|Q63JL6|TRUA_BURPS tRNA pseudouridine synthase A OS=Burkholderia pseudomallei (strain K96243) GN=truA PE=3 SV=1 90 372 4.0E-12
sp|A2S134|TRUA_BURM9 tRNA pseudouridine synthase A OS=Burkholderia mallei (strain NCTC 10229) GN=truA PE=3 SV=1 90 372 4.0E-12
sp|A3MBU2|TRUA_BURM7 tRNA pseudouridine synthase A OS=Burkholderia mallei (strain NCTC 10247) GN=truA PE=3 SV=1 90 372 4.0E-12
sp|A3NM70|TRUA_BURP6 tRNA pseudouridine synthase A OS=Burkholderia pseudomallei (strain 668) GN=truA PE=3 SV=1 90 372 4.0E-12
sp|Q3JKH3|TRUA_BURP1 tRNA pseudouridine synthase A OS=Burkholderia pseudomallei (strain 1710b) GN=truA PE=3 SV=1 90 372 4.0E-12
sp|A3P7N2|TRUA_BURP0 tRNA pseudouridine synthase A OS=Burkholderia pseudomallei (strain 1106a) GN=truA PE=3 SV=1 90 372 4.0E-12
sp|A1UZ38|TRUA_BURMS tRNA pseudouridine synthase A OS=Burkholderia mallei (strain SAVP1) GN=truA PE=3 SV=1 90 372 4.0E-12
sp|Q62AJ2|TRUA_BURMA tRNA pseudouridine synthase A OS=Burkholderia mallei (strain ATCC 23344) GN=truA PE=3 SV=1 90 372 4.0E-12
sp|Q87MP1|TRUA_VIBPA tRNA pseudouridine synthase A OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=truA PE=3 SV=1 90 388 4.0E-12
sp|B9DM46|TRUA_STACT tRNA pseudouridine synthase A OS=Staphylococcus carnosus (strain TM300) GN=truA PE=3 SV=1 90 361 4.0E-12
sp|O84469|TRUA_CHLTR tRNA pseudouridine synthase A OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=truA PE=3 SV=1 87 365 4.0E-12
sp|B0BCA1|TRUA_CHLTB tRNA pseudouridine synthase A OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=truA PE=3 SV=1 87 365 4.0E-12
sp|B0B836|TRUA_CHLT2 tRNA pseudouridine synthase A OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=truA PE=3 SV=1 87 365 4.0E-12
sp|B2A4Q5|TRUA_NATTJ tRNA pseudouridine synthase A OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=truA PE=3 SV=1 90 387 5.0E-12
sp|Q6HPM7|TRUA1_BACHK tRNA pseudouridine synthase A 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=truA1 PE=3 SV=1 90 388 6.0E-12
sp|Q63H59|TRUA1_BACCZ tRNA pseudouridine synthase A 1 OS=Bacillus cereus (strain ZK / E33L) GN=truA1 PE=3 SV=1 90 388 6.0E-12
sp|Q6I4Q2|TRUA1_BACAN tRNA pseudouridine synthase A 1 OS=Bacillus anthracis GN=truA1 PE=3 SV=1 90 388 6.0E-12
sp|C5CSH0|TRUA_VARPS tRNA pseudouridine synthase A OS=Variovorax paradoxus (strain S110) GN=truA PE=3 SV=1 90 362 6.0E-12
sp|Q604P1|TRUA_METCA tRNA pseudouridine synthase A OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=truA PE=3 SV=1 90 360 9.0E-12
sp|A4JMC2|TRUA_BURVG tRNA pseudouridine synthase A OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=truA PE=3 SV=1 90 387 2.0E-11
sp|Q2T7H3|TRUA_BURTA tRNA pseudouridine synthase A OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=truA PE=3 SV=1 90 372 2.0E-11
sp|B8G6P6|TRUA_CHLAD tRNA pseudouridine synthase A OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=truA PE=3 SV=1 88 349 3.0E-11
sp|Q8FS31|TRUA_COREF tRNA pseudouridine synthase A OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=truA PE=3 SV=2 90 400 4.0E-11
sp|A4IJL9|TRUA_GEOTN tRNA pseudouridine synthase A OS=Geobacillus thermodenitrificans (strain NG80-2) GN=truA PE=3 SV=1 87 386 5.0E-11
sp|A1VRR5|TRUA_POLNA tRNA pseudouridine synthase A OS=Polaromonas naphthalenivorans (strain CJ2) GN=truA PE=3 SV=1 90 360 7.0E-11
sp|A4G4G0|TRUA_HERAR tRNA pseudouridine synthase A OS=Herminiimonas arsenicoxydans GN=truA PE=3 SV=1 86 360 1.0E-10
sp|Q3A3B5|TRUA_PELCD tRNA pseudouridine synthase A OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=truA PE=3 SV=1 90 386 1.0E-10
sp|C3LTP7|TRUA_VIBCM tRNA pseudouridine synthase A OS=Vibrio cholerae serotype O1 (strain M66-2) GN=truA PE=3 SV=1 90 360 1.0E-10
sp|Q9KTA4|TRUA_VIBCH tRNA pseudouridine synthase A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=truA PE=3 SV=1 90 360 1.0E-10
sp|A5F2T4|TRUA_VIBC3 tRNA pseudouridine synthase A OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=truA PE=3 SV=1 90 360 1.0E-10
sp|B6IPI0|TRUA_RHOCS tRNA pseudouridine synthase A OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=truA PE=3 SV=1 92 360 1.0E-10
sp|B5Y955|TRUA_COPPD tRNA pseudouridine synthase A OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=truA PE=3 SV=1 87 365 2.0E-10
sp|Q168C1|TRUA_ROSDO tRNA pseudouridine synthase A OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=truA PE=3 SV=1 91 370 3.0E-10
sp|C5D3U9|TRUA_GEOSW tRNA pseudouridine synthase A OS=Geobacillus sp. (strain WCH70) GN=truA PE=3 SV=1 87 349 5.0E-10
sp|A1S7J9|TRUA_SHEAM tRNA pseudouridine synthase A OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=truA PE=3 SV=1 90 395 6.0E-10
sp|Q46YW3|TRUA_CUPPJ tRNA pseudouridine synthase A OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=truA PE=3 SV=1 90 395 6.0E-10
sp|Q7TU07|TRUA_RHOBA tRNA pseudouridine synthase A OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=truA PE=3 SV=1 88 360 6.0E-10
sp|A5USG0|TRUA_ROSS1 tRNA pseudouridine synthase A OS=Roseiflexus sp. (strain RS-1) GN=truA PE=3 SV=1 88 378 1.0E-09
sp|P60349|TRUA_CORDI tRNA pseudouridine synthase A OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=truA PE=3 SV=1 87 400 1.0E-09
sp|A8F526|TRUA_PSELT tRNA pseudouridine synthase A OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=truA PE=3 SV=1 136 362 1.0E-09
sp|Q5HM30|TRUA_STAEQ tRNA pseudouridine synthase A OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=truA PE=3 SV=1 148 361 1.0E-09
sp|Q8CML6|TRUA_STAES tRNA pseudouridine synthase A OS=Staphylococcus epidermidis (strain ATCC 12228) GN=truA PE=3 SV=1 148 361 2.0E-09
sp|B7IHS2|TRUA_THEAB tRNA pseudouridine synthase A OS=Thermosipho africanus (strain TCF52B) GN=truA PE=3 SV=1 90 361 2.0E-09
sp|Q89ZY4|TRUA_BACTN tRNA pseudouridine synthase A OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=truA PE=3 SV=1 92 349 2.0E-09
sp|Q8TWZ3|TRUA_METKA tRNA pseudouridine synthase A OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=truA PE=3 SV=1 90 389 2.0E-09
sp|Q5Z1K7|TRUA_NOCFA tRNA pseudouridine synthase A OS=Nocardia farcinica (strain IFM 10152) GN=truA PE=3 SV=1 144 394 3.0E-09
sp|Q9RS37|TRUA_DEIRA tRNA pseudouridine synthase A OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=truA PE=3 SV=1 207 349 3.0E-09
sp|Q4L882|TRUA_STAHJ tRNA pseudouridine synthase A OS=Staphylococcus haemolyticus (strain JCSC1435) GN=truA PE=3 SV=1 210 361 3.0E-09
sp|O86776|TRUA_STRCO tRNA pseudouridine synthase A OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=truA PE=3 SV=1 90 394 3.0E-09
sp|Q82DM1|TRUA_STRAW tRNA pseudouridine synthase A OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=truA PE=3 SV=1 90 394 5.0E-09
sp|Q83WJ5|TRUA_BURM1 tRNA pseudouridine synthase A OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=truA PE=3 SV=1 90 387 5.0E-09
sp|B3E0A0|TRUA_METI4 tRNA pseudouridine synthase A OS=Methylacidiphilum infernorum (isolate V4) GN=truA PE=3 SV=1 92 349 6.0E-09
sp|Q64XV0|TRUA_BACFR tRNA pseudouridine synthase A OS=Bacteroides fragilis (strain YCH46) GN=truA PE=3 SV=1 92 356 6.0E-09
sp|Q21XI4|TRUA_RHOFT tRNA pseudouridine synthase A OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=truA PE=3 SV=1 90 360 6.0E-09
sp|Q5LGZ6|TRUA_BACFN tRNA pseudouridine synthase A OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=truA PE=3 SV=1 92 349 8.0E-09
sp|A9BGW7|TRUA_PETMO tRNA pseudouridine synthase A OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=truA PE=3 SV=1 88 369 1.0E-08
sp|Q5M6C9|TRUA_STRT2 tRNA pseudouridine synthase A OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=truA PE=3 SV=1 88 361 2.0E-08
sp|Q5M1T6|TRUA_STRT1 tRNA pseudouridine synthase A OS=Streptococcus thermophilus (strain CNRZ 1066) GN=truA PE=3 SV=1 88 361 2.0E-08
sp|Q93NE2|TRUA_MYXXA tRNA pseudouridine synthase A OS=Myxococcus xanthus GN=truA PE=3 SV=1 90 360 3.0E-08
sp|Q03MR4|TRUA_STRTD tRNA pseudouridine synthase A OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=truA PE=3 SV=1 87 349 3.0E-08
sp|A4VT40|TRUA_STRSY tRNA pseudouridine synthase A OS=Streptococcus suis (strain 05ZYH33) GN=truA PE=3 SV=1 87 360 6.0E-08
sp|Q59069|TRUA_METJA tRNA pseudouridine synthase A OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=truA PE=3 SV=1 92 371 8.0E-08
sp|A4VZC6|TRUA_STRS2 tRNA pseudouridine synthase A OS=Streptococcus suis (strain 98HAH33) GN=truA PE=3 SV=1 87 360 9.0E-08
sp|P9WHP9|TRUA_MYCTU tRNA pseudouridine synthase A OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=truA PE=1 SV=1 92 392 2.0E-07
sp|P9WHP8|TRUA_MYCTO tRNA pseudouridine synthase A OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=truA PE=3 SV=1 92 392 2.0E-07
sp|P65847|TRUA_MYCBO tRNA pseudouridine synthase A OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=truA PE=3 SV=1 92 392 2.0E-07
sp|Q5SHU9|TRUA_THET8 tRNA pseudouridine synthase A OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=truA PE=1 SV=1 190 393 2.0E-07
sp|Q72I65|TRUA_THET2 tRNA pseudouridine synthase A OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=truA PE=3 SV=1 190 393 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0009451 RNA modification Yes
GO:0001522 pseudouridine synthesis Yes
GO:0009982 pseudouridine synthase activity Yes
GO:0003723 RNA binding Yes
GO:0043412 macromolecule modification No
GO:0044237 cellular metabolic process No
GO:0044238 primary metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0003824 catalytic activity No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0016853 isomerase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0016866 intramolecular transferase activity No
GO:0046483 heterocycle metabolic process No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0016070 RNA metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1563
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6596
Ophiocordyceps australis map64 (Brazil) OphauB2|6124
Ophiocordyceps camponoti-floridani Ophcf2|05820
Ophiocordyceps camponoti-rufipedis Ophun1|739 (this protein)
Ophiocordyceps kimflemingae Ophio5|5761
Ophiocordyceps subramaniannii Hirsu2|1145

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|739
MRLSAGSLRLSLRLRSRTPVLPSCSRSVSSRSMADDDYESWTRTALIRRLRALDAETKTRPPLADKENIAPLPTK
TKPAFDPSRYSTRYIALKLAYLGKRYGGFEFQPMGNQPTIEEELWNAMSKACLVFPDGPVDAVQFDCCQYSKGGR
TDRGVSAFGQVISLRVRSNRPLKVRRERVDEEEEVDKDGDEEETPPFDDIADELCYPRILNRILPPDIRILAWCP
SPPPDFSARFSCRQRQYRYFFTQPAFAGGRLDIAAMRDAAKRFEGDHDFRNLCKVDPAKQIANFRRRIFEADIVE
MEDSRVALPPHGTETGEDGKVYYFLVRGTAFLWHQIRHMVAVLFLVGQGFEKPSIVSRLLDVDATPCKPTYVMAD
EVPLVLWDCAYPDLEKLDAGAQMNKFEDALRWIYVGDDAPADKFGPHGVVDRLWRLWRECKIDELLSRELLRLAT
TQGAMLRRGQDKELRRKAGITMFEGGNGGRPAGKAE*
Coding >Ophun1|739
ATGCGCCTCTCGGCCGGCTCTCTCCGCCTCAGCCTCCGCCTCCGATCCCGGACCCCCGTTCTGCCGTCCTGCAGC
CGGTCCGTCTCGTCCAGAAGCATGGCCGATGACGACTACGAGAGCTGGACACGGACGGCCCTCATACGGCGACTG
CGGGCGCTCGATGCGGAGACGAAGACGCGTCCTCCGTTGGCCGACAAGGAGAACATCGCCCCGTTACCGACCAAG
ACGAAGCCCGCCTTCGATCCGTCCCGATACTCGACGCGCTACATCGCCCTCAAGCTGGCCTACCTCGGTAAGCGC
TATGGCGGCTTCGAGTTTCAGCCCATGGGGAACCAGCCGACCATCGAGGAGGAGCTGTGGAACGCGATGTCAAAG
GCCTGTCTCGTCTTTCCAGATGGCCCCGTCGATGCCGTCCAGTTCGACTGCTGCCAGTACTCCAAGGGTGGTCGA
ACCGATCGTGGTGTCAGCGCCTTTGGCCAGGTCATCAGTCTGCGCGTGCGGAGCAACAGGCCGCTGAAGGTCCGT
CGAGAGAGAGTCGATGAGGAGGAAGAGGTCGACAAGGATGGAGACGAGGAGGAGACGCCGCCTTTCGACGACATC
GCTGACGAGCTCTGCTACCCGCGCATCCTCAACCGCATCCTCCCGCCCGACATCCGCATCCTGGCCTGGTGTCCG
TCGCCGCCGCCCGACTTTTCCGCTCGCTTCTCTTGTCGCCAACGCCAGTACCGATACTTCTTCACCCAGCCGGCC
TTTGCTGGCGGCCGGCTAGACATTGCGGCGATGCGCGACGCGGCCAAGCGCTTCGAGGGTGATCACGACTTTCGC
AACCTGTGCAAGGTCGATCCGGCAAAGCAGATTGCCAACTTTCGCCGGCGCATCTTCGAGGCTGACATCGTCGAG
ATGGAAGATTCACGCGTGGCCTTGCCCCCTCACGGCACGGAGACGGGAGAGGACGGCAAGGTCTATTACTTTCTT
GTCCGAGGCACGGCCTTTCTGTGGCATCAGATCCGCCACATGGTCGCCGTCCTGTTCCTCGTGGGTCAGGGTTTC
GAGAAGCCGAGTATCGTGTCGCGGCTGCTCGACGTGGATGCCACCCCGTGCAAGCCGACGTACGTCATGGCCGAC
GAAGTGCCACTCGTACTGTGGGATTGCGCCTATCCAGACTTGGAGAAGCTGGACGCGGGTGCGCAGATGAACAAG
TTCGAGGACGCGCTGCGGTGGATATACGTCGGTGACGATGCGCCGGCCGACAAGTTTGGCCCGCACGGAGTCGTC
GACCGGCTCTGGCGGCTGTGGCGAGAGTGCAAGATTGACGAGCTGCTGTCGCGTGAGTTGCTGCGGCTGGCCACG
ACCCAAGGTGCGATGCTGCGACGAGGCCAAGACAAGGAGCTGAGGCGCAAGGCCGGTATCACCATGTTCGAGGGA
GGCAACGGCGGAAGGCCCGCGGGCAAAGCAGAATGA
Transcript >Ophun1|739
ATGCGCCTCTCGGCCGGCTCTCTCCGCCTCAGCCTCCGCCTCCGATCCCGGACCCCCGTTCTGCCGTCCTGCAGC
CGGTCCGTCTCGTCCAGAAGCATGGCCGATGACGACTACGAGAGCTGGACACGGACGGCCCTCATACGGCGACTG
CGGGCGCTCGATGCGGAGACGAAGACGCGTCCTCCGTTGGCCGACAAGGAGAACATCGCCCCGTTACCGACCAAG
ACGAAGCCCGCCTTCGATCCGTCCCGATACTCGACGCGCTACATCGCCCTCAAGCTGGCCTACCTCGGTAAGCGC
TATGGCGGCTTCGAGTTTCAGCCCATGGGGAACCAGCCGACCATCGAGGAGGAGCTGTGGAACGCGATGTCAAAG
GCCTGTCTCGTCTTTCCAGATGGCCCCGTCGATGCCGTCCAGTTCGACTGCTGCCAGTACTCCAAGGGTGGTCGA
ACCGATCGTGGTGTCAGCGCCTTTGGCCAGGTCATCAGTCTGCGCGTGCGGAGCAACAGGCCGCTGAAGGTCCGT
CGAGAGAGAGTCGATGAGGAGGAAGAGGTCGACAAGGATGGAGACGAGGAGGAGACGCCGCCTTTCGACGACATC
GCTGACGAGCTCTGCTACCCGCGCATCCTCAACCGCATCCTCCCGCCCGACATCCGCATCCTGGCCTGGTGTCCG
TCGCCGCCGCCCGACTTTTCCGCTCGCTTCTCTTGTCGCCAACGCCAGTACCGATACTTCTTCACCCAGCCGGCC
TTTGCTGGCGGCCGGCTAGACATTGCGGCGATGCGCGACGCGGCCAAGCGCTTCGAGGGTGATCACGACTTTCGC
AACCTGTGCAAGGTCGATCCGGCAAAGCAGATTGCCAACTTTCGCCGGCGCATCTTCGAGGCTGACATCGTCGAG
ATGGAAGATTCACGCGTGGCCTTGCCCCCTCACGGCACGGAGACGGGAGAGGACGGCAAGGTCTATTACTTTCTT
GTCCGAGGCACGGCCTTTCTGTGGCATCAGATCCGCCACATGGTCGCCGTCCTGTTCCTCGTGGGTCAGGGTTTC
GAGAAGCCGAGTATCGTGTCGCGGCTGCTCGACGTGGATGCCACCCCGTGCAAGCCGACGTACGTCATGGCCGAC
GAAGTGCCACTCGTACTGTGGGATTGCGCCTATCCAGACTTGGAGAAGCTGGACGCGGGTGCGCAGATGAACAAG
TTCGAGGACGCGCTGCGGTGGATATACGTCGGTGACGATGCGCCGGCCGACAAGTTTGGCCCGCACGGAGTCGTC
GACCGGCTCTGGCGGCTGTGGCGAGAGTGCAAGATTGACGAGCTGCTGTCGCGTGAGTTGCTGCGGCTGGCCACG
ACCCAAGGTGCGATGCTGCGACGAGGCCAAGACAAGGAGCTGAGGCGCAAGGCCGGTATCACCATGTTCGAGGGA
GGCAACGGCGGAAGGCCCGCGGGCAAAGCAGAATGA
Gene >Ophun1|739
ATGCGCCTCTCGGCCGGCTCTCTCCGCCTCAGCCTCCGCCTCCGATCCCGGACCCCCGTTCTGCCGTCCTGCAGC
CGGTCCGTCTCGTCCAGAAGCATGGCCGATGACGACTACGAGAGCTGGACACGGACGGCCCTCATACGGCGACTG
CGGGCGCTCGATGCGGAGACGAAGACGCGTCCTCCGTTGGCCGACAAGGAGAACATCGCCCCGTTACCGACCAAG
ACGAAGCCCGCCTTCGATCCGTCCCGATACTCGACGCGCTACATCGCCCTCAAGCTGGCCTACCTCGGTAAGCGC
TATGGCGGCTTCGAGTTTCAGCCCATGGGGAACCAGCCGACCATCGAGGAGGAGCTGTGGAACGCGATGTCAAAG
GCCTGTCTCGTCTTTCCAGATGGCCCCGTCGATGCCGTCCAGTTCGACTGCTGCCAGTACTCCAAGGGTGGTCGA
ACCGATCGTGGTGTCAGCGCCTTTGGCCAGGTCATCAGTCTGCGCGTGCGGAGCAACAGGCCGCTGAAGGTCCGT
CGAGAGAGAGTCGATGAGGAGGAAGAGGTCGACAAGGATGGAGACGAGGAGGAGACGCCGCCTTTCGACGACATC
GCTGACGAGCTCTGCTACCCGCGCATCCTCAACCGCATCCTCCCGCCCGACATCCGCATCCTGGCCTGGTGTCCG
TCGCCGCCGCCCGACTTTTCCGCTCGCTTCTCTTGTCGCCAACGCCAGTACCGATACTTCTTCACCCAGCCGGCC
TTTGCTGGCGGCCGGCTAGACATTGCGGCGATGCGCGACGCGGCCAAGCGCTTCGAGGGTGATCACGACTTTCGC
AACCTGTGCAAGGTCGATCCGGCAAAGCAGATTGCCAACTTTCGCCGGCGCATCTTCGAGGCTGACATCGTCGAG
ATGGAAGATTCACGCGTGGCCTTGCCCCCTCACGGCACGGAGACGGGAGAGGACGGCAAGGTCTATTACTTTCTT
GTCCGAGGCACGGCCTTTCTGTGGCATCAGATCCGCCACATGGTCGCCGTCCTGTTCCTCGTGGGTCAGGGTTTC
GAGAAGCCGAGTATCGTGTCGCGGCTGCTCGACGTGGATGCCACCCCGTGCAAGCCGACGTACGTCATGGCCGAC
GAAGTGCCACTCGTACTGTGGGATTGCGCCTATCCAGACTTGGAGAAGCTGGACGCGGGTGCGCAGATGAACAAG
TTCGAGGACGCGCTGCGGTGGATATACGTCGGTGACGATGCGCCGGCCGACAAGTTTGGCCCGCACGGAGTCGTC
GACCGGCTCTGGCGGCTGTGGCGAGAGTGCAAGATTGACGAGCTGCTGTCGCGTGAGTTGCTGCGGCTGGCCACG
ACCCAAGGTGCGATGCTGCGACGAGGCCAAGACAAGGAGCTGAGGCGCAAGGCCGGTATCACCATGTTCGAGGGA
GGCAACGGCGGAAGGCCCGCGGGCAAGTACGTGGCGTTGATGAACAGGGCCGTGGTGGAGTCGCCGGAAGAGCAG
AATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail