Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7384
Gene name
LocationContig_919:4453..5259
Strand-
Gene length (bp)806
Transcript length (bp)750
Coding sequence length (bp)750
Protein length (aa) 250

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03959 FSH1 Serine hydrolase (FSH1) 3.7E-55 1 230
PF08237 PE-PPE PE-PPE domain 9.1E-05 83 133

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P36591|DYR_SCHPO Dihydrofolate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dfr1 PE=2 SV=2 6 223 1.0E-29
sp|O13897|YF36_SCHPO Uncharacterized hydrolase C22A12.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22A12.06c PE=3 SV=1 2 236 3.0E-24
sp|Q05015|FSH2_YEAST Family of serine hydrolases 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FSH2 PE=1 SV=1 5 238 2.0E-20
sp|Q99369|FSH3_YEAST Family of serine hydrolases 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FSH3 PE=2 SV=1 7 237 6.0E-19
sp|Q503Y4|OVCA2_DANRE Ovarian cancer-associated gene 2 protein homolog OS=Danio rerio GN=ovca2 PE=2 SV=1 1 237 2.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P36591|DYR_SCHPO Dihydrofolate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dfr1 PE=2 SV=2 6 223 1.0E-29
sp|O13897|YF36_SCHPO Uncharacterized hydrolase C22A12.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22A12.06c PE=3 SV=1 2 236 3.0E-24
sp|Q05015|FSH2_YEAST Family of serine hydrolases 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FSH2 PE=1 SV=1 5 238 2.0E-20
sp|Q99369|FSH3_YEAST Family of serine hydrolases 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FSH3 PE=2 SV=1 7 237 6.0E-19
sp|Q503Y4|OVCA2_DANRE Ovarian cancer-associated gene 2 protein homolog OS=Danio rerio GN=ovca2 PE=2 SV=1 1 237 2.0E-18
sp|P38777|FSH1_YEAST Family of serine hydrolases 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FSH1 PE=1 SV=1 1 232 2.0E-15
sp|A4II73|OVCA2_XENTR Ovarian cancer-associated gene 2 protein homolog OS=Xenopus tropicalis GN=ovca2 PE=2 SV=2 6 223 2.0E-14
sp|Q0C7C4|U483_AEDAE UPF0483 protein AAEL000016 OS=Aedes aegypti GN=AAEL000016 PE=3 SV=1 4 238 3.0E-14
sp|Q61YZ4|U483_CAEBR UPF0483 protein CBG03338 OS=Caenorhabditis briggsae GN=CBG03338 PE=3 SV=1 2 239 4.0E-14
sp|Q7QBJ0|U483_ANOGA UPF0483 protein AGAP003155 OS=Anopheles gambiae GN=AGAP003155 PE=3 SV=3 6 239 6.0E-14
sp|Q18169|U483_CAEEL UPF0483 protein C25G4.2 OS=Caenorhabditis elegans GN=C25G4.2 PE=3 SV=1 2 242 1.0E-13
sp|Q9D7E3|OVCA2_MOUSE Ovarian cancer-associated gene 2 protein homolog OS=Mus musculus GN=Ovca2 PE=1 SV=1 5 223 2.0E-12
sp|Q9VDL1|U483_DROME UPF0483 protein CG5412 OS=Drosophila melanogaster GN=CG5412 PE=2 SV=1 6 238 3.0E-12
sp|Q29BR3|U483_DROPS UPF0483 protein GA18864 OS=Drosophila pseudoobscura pseudoobscura GN=GA18864 PE=3 SV=1 6 238 1.0E-11
sp|Q3SZ07|OVCA2_BOVIN Ovarian cancer-associated gene 2 protein homolog OS=Bos taurus GN=OVCA2 PE=2 SV=1 6 223 3.0E-09
sp|Q8WZ82|OVCA2_HUMAN Ovarian cancer-associated gene 2 protein OS=Homo sapiens GN=OVCA2 PE=1 SV=1 6 223 5.0E-08
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5028
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1523
Ophiocordyceps australis map64 (Brazil) OphauB2|1513
Ophiocordyceps camponoti-floridani Ophcf2|02661
Ophiocordyceps camponoti-rufipedis Ophun1|7384 (this protein)
Ophiocordyceps kimflemingae Ophio5|2224
Ophiocordyceps subramaniannii Hirsu2|2586

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7384
MSPSTIKVLMLHGYTQSGPIFRAKTRALEKLLVKALAPSSLSPVLLYPTAPIRLLAKDVPGFVDNGDDDDSQRSD
ARAWFRRDDATGVYVSLAEGMSVIADAIREAGGVDAVCGFSQGALVASLVTAALEPTRQVPEGSDSAAWVRNLRE
ANRGRPLRFGVFYSGFVARADGLEWCHDPKLDTPTLHYMGSLDTVVSESRNRELAEKCRGSVIVVHPGAHYVPVT
REWVMPLAGFIREHASRAQCMAGL*
Coding >Ophun1|7384
ATGTCCCCCTCCACAATAAAGGTGCTCATGCTCCACGGCTACACCCAATCCGGCCCCATCTTCCGCGCCAAGACG
CGCGCCCTCGAAAAGCTCCTCGTCAAGGCCCTCGCCCCCTCGTCGCTAAGTCCCGTATTGCTCTACCCTACGGCC
CCGATCCGGCTCCTCGCCAAGGACGTACCCGGCTTCGTCGATAACGGCGACGACGACGACAGCCAACGGTCCGAT
GCCCGGGCTTGGTTCCGTCGAGATGATGCGACGGGCGTCTACGTCTCGCTCGCTGAGGGCATGAGCGTCATTGCC
GACGCCATTCGCGAAGCTGGCGGCGTCGATGCCGTCTGTGGATTCAGTCAGGGCGCTCTCGTCGCCTCGCTCGTT
ACTGCGGCGCTGGAACCGACGAGACAGGTGCCGGAAGGGTCGGATTCCGCTGCTTGGGTCAGGAATTTGCGCGAG
GCCAATCGTGGAAGGCCTCTTCGCTTCGGCGTCTTCTACTCGGGCTTCGTTGCGCGCGCCGACGGCCTCGAATGG
TGCCATGATCCCAAGCTGGATACGCCGACCCTCCACTACATGGGCAGCCTCGACACCGTCGTCAGTGAGAGCCGC
AATCGCGAACTCGCCGAAAAGTGCCGGGGTAGTGTCATTGTCGTCCATCCGGGTGCGCATTACGTTCCCGTAACT
AGGGAATGGGTCATGCCCTTGGCCGGCTTCATCAGGGAACACGCTTCGAGAGCGCAGTGCATGGCAGGGCTGTGA
Transcript >Ophun1|7384
ATGTCCCCCTCCACAATAAAGGTGCTCATGCTCCACGGCTACACCCAATCCGGCCCCATCTTCCGCGCCAAGACG
CGCGCCCTCGAAAAGCTCCTCGTCAAGGCCCTCGCCCCCTCGTCGCTAAGTCCCGTATTGCTCTACCCTACGGCC
CCGATCCGGCTCCTCGCCAAGGACGTACCCGGCTTCGTCGATAACGGCGACGACGACGACAGCCAACGGTCCGAT
GCCCGGGCTTGGTTCCGTCGAGATGATGCGACGGGCGTCTACGTCTCGCTCGCTGAGGGCATGAGCGTCATTGCC
GACGCCATTCGCGAAGCTGGCGGCGTCGATGCCGTCTGTGGATTCAGTCAGGGCGCTCTCGTCGCCTCGCTCGTT
ACTGCGGCGCTGGAACCGACGAGACAGGTGCCGGAAGGGTCGGATTCCGCTGCTTGGGTCAGGAATTTGCGCGAG
GCCAATCGTGGAAGGCCTCTTCGCTTCGGCGTCTTCTACTCGGGCTTCGTTGCGCGCGCCGACGGCCTCGAATGG
TGCCATGATCCCAAGCTGGATACGCCGACCCTCCACTACATGGGCAGCCTCGACACCGTCGTCAGTGAGAGCCGC
AATCGCGAACTCGCCGAAAAGTGCCGGGGTAGTGTCATTGTCGTCCATCCGGGTGCGCATTACGTTCCCGTAACT
AGGGAATGGGTCATGCCCTTGGCCGGCTTCATCAGGGAACACGCTTCGAGAGCGCAGTGCATGGCAGGGCTGTGA
Gene >Ophun1|7384
ATGTCCCCCTCCACAATAAAGGTGCTCATGCTCCACGGTCCGTCCCTACGTAACCCCCCCTAAAATCAACGCTCG
CTCAAGGAAACCCTCAAGGCTACACCCAATCCGGCCCCATCTTCCGCGCCAAGACGCGCGCCCTCGAAAAGCTCC
TCGTCAAGGCCCTCGCCCCCTCGTCGCTAAGTCCCGTATTGCTCTACCCTACGGCCCCGATCCGGCTCCTCGCCA
AGGACGTACCCGGCTTCGTCGATAACGGCGACGACGACGACAGCCAACGGTCCGATGCCCGGGCTTGGTTCCGTC
GAGATGATGCGACGGGCGTCTACGTCTCGCTCGCTGAGGGCATGAGCGTCATTGCCGACGCCATTCGCGAAGCTG
GCGGCGTCGATGCCGTCTGTGGATTCAGTCAGGGCGCTCTCGTCGCCTCGCTCGTTACTGCGGCGCTGGAACCGA
CGAGACAGGTGCCGGAAGGGTCGGATTCCGCTGCTTGGGTCAGGAATTTGCGCGAGGCCAATCGTGGAAGGCCTC
TTCGCTTCGGCGTCTTCTACTCGGGCTTCGTTGCGCGCGCCGACGGCCTCGAATGGTGCCATGATCCCAAGCTGG
ATACGCCGACCCTCCACTACATGGGCAGCCTCGACACCGTCGTCAGTGAGAGCCGCAATCGCGAACTCGCCGAAA
AGTGCCGGGGTAGTGTCATTGTCGTCCATCCGGGTGCGCATTACGTTCCCGTAACTAGGGAATGGGTCATGCCCT
TGGCCGGCTTCATCAGGGAACACGCTTCGAGAGCGCAGTGCATGGCAGGGCTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail