Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7383
Gene name
LocationContig_919:2671..4294
Strand+
Gene length (bp)1623
Transcript length (bp)1452
Coding sequence length (bp)1452
Protein length (aa) 484

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01399 PCI PCI domain 6.4E-22 327 438
PF18098 RPN5_C 26S proteasome regulatory subunit RPN5 C-terminal domain 5.7E-16 444 476

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9D8W5|PSD12_MOUSE 26S proteasome non-ATPase regulatory subunit 12 OS=Mus musculus GN=Psmd12 PE=1 SV=4 6 478 1.0E-146
sp|Q2KJ25|PSD12_BOVIN 26S proteasome non-ATPase regulatory subunit 12 OS=Bos taurus GN=PSMD12 PE=2 SV=3 6 478 2.0E-144
sp|O00232|PSD12_HUMAN 26S proteasome non-ATPase regulatory subunit 12 OS=Homo sapiens GN=PSMD12 PE=1 SV=3 6 478 2.0E-144
sp|Q5RBI3|PSD12_PONAB 26S proteasome non-ATPase regulatory subunit 12 OS=Pongo abelii GN=PSMD12 PE=2 SV=3 6 478 3.0E-144
sp|Q9UTM3|RPN5_SCHPO 26S proteasome regulatory subunit rpn5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpn501 PE=1 SV=1 7 483 3.0E-138
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9D8W5|PSD12_MOUSE 26S proteasome non-ATPase regulatory subunit 12 OS=Mus musculus GN=Psmd12 PE=1 SV=4 6 478 1.0E-146
sp|Q2KJ25|PSD12_BOVIN 26S proteasome non-ATPase regulatory subunit 12 OS=Bos taurus GN=PSMD12 PE=2 SV=3 6 478 2.0E-144
sp|O00232|PSD12_HUMAN 26S proteasome non-ATPase regulatory subunit 12 OS=Homo sapiens GN=PSMD12 PE=1 SV=3 6 478 2.0E-144
sp|Q5RBI3|PSD12_PONAB 26S proteasome non-ATPase regulatory subunit 12 OS=Pongo abelii GN=PSMD12 PE=2 SV=3 6 478 3.0E-144
sp|Q9UTM3|RPN5_SCHPO 26S proteasome regulatory subunit rpn5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpn501 PE=1 SV=1 7 483 3.0E-138
sp|Q12250|RPN5_YEAST 26S proteasome regulatory subunit RPN5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPN5 PE=1 SV=3 3 478 1.0E-126
sp|Q54UJ0|PSD12_DICDI 26S proteasome non-ATPase regulatory subunit 12 OS=Dictyostelium discoideum GN=psmD12 PE=2 SV=1 7 478 2.0E-108
sp|Q9FIB6|PS12A_ARATH 26S proteasome non-ATPase regulatory subunit 12 homolog A OS=Arabidopsis thaliana GN=RPN5A PE=1 SV=1 31 479 9.0E-105
sp|Q8VWK0|PS12B_ARATH 26S proteasome non-ATPase regulatory subunit 12 homolog B OS=Arabidopsis thaliana GN=RPN5B PE=1 SV=1 31 477 7.0E-102
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup764
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1522
Ophiocordyceps australis 1348a (Ghana) OphauG2|7699
Ophiocordyceps australis map64 (Brazil) OphauB2|1512
Ophiocordyceps camponoti-floridani Ophcf2|02662
Ophiocordyceps camponoti-rufipedis Ophun1|7383 (this protein)
Ophiocordyceps kimflemingae Ophio5|2223
Ophiocordyceps subramaniannii Hirsu2|2585

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7383
MSEGALKPEKDFSKDVDQQLPEAEALAKTNLQGAIEKLTALEKQTRQASDLASTSRVIIAIVTLCKDAGDWSLMN
DQTLVLSKKHSQLKQAITKMVQTVVGFLDDTPDIKTKLSVIDTLRTVTEGKIFVEVERARVTKILSDMKKSQGEL
KAATEILCELQVETFGSMGRREKTEFILAQVALCIESGDWTQAGILARKISTKYLSRKPKKTAEELEKARQEREK
KRGPGEEEVRDDLDDDTTDLRLRYYEQQIMLAKHEGKYLDVCKHYRQVLDTEAVEEDPAKLHPVLQRIIYFAILA
PYDNEQHDLLHRIHRDTRNSQIPMDAELLRFFTVHELMRWPEIANKFGPHLCSTDVFDSQAGQSSDDKAHQRWED
LRKRVIEHNVRVVAKYYTRIQMKRLTELLDLTEDETEKYISELVTSKTVYAKIDRPARVVSFAKPSSADDVLNEW
SHNMKNLLGLLERIDHLITKEEMMARIQPTSAK*
Coding >Ophun1|7383
ATGTCCGAGGGAGCGCTGAAACCGGAGAAGGACTTCTCCAAGGATGTCGACCAGCAGCTTCCAGAGGCCGAAGCG
CTGGCAAAGACCAACCTTCAAGGAGCCATCGAGAAGCTCACAGCGCTAGAGAAACAGACGCGTCAAGCTTCGGAT
CTGGCGTCGACGTCGCGCGTCATAATAGCCATCGTCACCCTCTGCAAAGATGCCGGCGACTGGAGCTTGATGAAC
GACCAGACGCTGGTTCTGTCCAAGAAGCACAGTCAGCTCAAGCAGGCCATCACCAAGATGGTCCAAACCGTCGTT
GGCTTCCTCGACGACACGCCCGACATCAAGACGAAGCTCTCTGTCATCGACACGCTGCGGACGGTGACCGAGGGC
AAGATATTCGTCGAGGTCGAGCGCGCTCGCGTCACCAAGATTCTGTCGGATATGAAGAAGTCTCAAGGCGAACTC
AAGGCCGCCACCGAGATTCTCTGCGAGCTGCAGGTCGAGACGTTTGGCTCCATGGGTCGACGGGAGAAGACAGAG
TTCATTCTGGCTCAGGTCGCTCTCTGCATTGAGAGCGGCGACTGGACGCAGGCCGGCATCTTGGCTCGCAAAATC
AGCACCAAGTACCTGTCCCGCAAGCCCAAGAAGACGGCCGAGGAACTGGAAAAGGCCAGACAGGAGCGCGAGAAG
AAGAGGGGACCCGGCGAGGAGGAAGTCCGCGATGACTTGGACGATGATACGACGGATCTGAGGCTGCGCTACTAC
GAGCAGCAAATCATGCTTGCCAAGCACGAGGGCAAATATCTCGACGTCTGCAAGCACTACCGGCAGGTTCTCGAC
ACGGAGGCCGTGGAGGAGGATCCGGCCAAGCTTCATCCCGTCCTTCAACGCATCATCTACTTTGCCATTCTCGCC
CCTTACGACAACGAACAACACGACCTCCTGCACCGCATCCACCGCGATACGCGCAACTCGCAAATCCCCATGGAC
GCCGAGCTCCTCCGCTTCTTCACCGTACACGAGCTGATGCGGTGGCCCGAGATTGCCAACAAGTTTGGCCCGCAC
CTGTGCAGCACCGACGTCTTCGACTCCCAGGCAGGCCAGTCTTCGGACGACAAGGCGCATCAGCGATGGGAGGAT
CTCCGGAAGCGCGTCATCGAGCACAACGTCCGCGTCGTGGCCAAGTATTACACGCGCATCCAGATGAAGCGCCTG
ACGGAGCTCCTGGACCTGACGGAGGACGAGACGGAAAAGTACATTAGCGAGCTGGTCACGTCCAAGACGGTATAT
GCCAAGATTGACCGGCCGGCGCGCGTCGTCAGCTTCGCCAAGCCGAGCAGCGCCGACGACGTGCTGAACGAATGG
AGCCACAACATGAAGAACCTGCTGGGTTTGCTGGAGAGGATCGACCACCTGATTACCAAGGAGGAGATGATGGCG
CGCATACAGCCGACGAGCGCAAAGTAG
Transcript >Ophun1|7383
ATGTCCGAGGGAGCGCTGAAACCGGAGAAGGACTTCTCCAAGGATGTCGACCAGCAGCTTCCAGAGGCCGAAGCG
CTGGCAAAGACCAACCTTCAAGGAGCCATCGAGAAGCTCACAGCGCTAGAGAAACAGACGCGTCAAGCTTCGGAT
CTGGCGTCGACGTCGCGCGTCATAATAGCCATCGTCACCCTCTGCAAAGATGCCGGCGACTGGAGCTTGATGAAC
GACCAGACGCTGGTTCTGTCCAAGAAGCACAGTCAGCTCAAGCAGGCCATCACCAAGATGGTCCAAACCGTCGTT
GGCTTCCTCGACGACACGCCCGACATCAAGACGAAGCTCTCTGTCATCGACACGCTGCGGACGGTGACCGAGGGC
AAGATATTCGTCGAGGTCGAGCGCGCTCGCGTCACCAAGATTCTGTCGGATATGAAGAAGTCTCAAGGCGAACTC
AAGGCCGCCACCGAGATTCTCTGCGAGCTGCAGGTCGAGACGTTTGGCTCCATGGGTCGACGGGAGAAGACAGAG
TTCATTCTGGCTCAGGTCGCTCTCTGCATTGAGAGCGGCGACTGGACGCAGGCCGGCATCTTGGCTCGCAAAATC
AGCACCAAGTACCTGTCCCGCAAGCCCAAGAAGACGGCCGAGGAACTGGAAAAGGCCAGACAGGAGCGCGAGAAG
AAGAGGGGACCCGGCGAGGAGGAAGTCCGCGATGACTTGGACGATGATACGACGGATCTGAGGCTGCGCTACTAC
GAGCAGCAAATCATGCTTGCCAAGCACGAGGGCAAATATCTCGACGTCTGCAAGCACTACCGGCAGGTTCTCGAC
ACGGAGGCCGTGGAGGAGGATCCGGCCAAGCTTCATCCCGTCCTTCAACGCATCATCTACTTTGCCATTCTCGCC
CCTTACGACAACGAACAACACGACCTCCTGCACCGCATCCACCGCGATACGCGCAACTCGCAAATCCCCATGGAC
GCCGAGCTCCTCCGCTTCTTCACCGTACACGAGCTGATGCGGTGGCCCGAGATTGCCAACAAGTTTGGCCCGCAC
CTGTGCAGCACCGACGTCTTCGACTCCCAGGCAGGCCAGTCTTCGGACGACAAGGCGCATCAGCGATGGGAGGAT
CTCCGGAAGCGCGTCATCGAGCACAACGTCCGCGTCGTGGCCAAGTATTACACGCGCATCCAGATGAAGCGCCTG
ACGGAGCTCCTGGACCTGACGGAGGACGAGACGGAAAAGTACATTAGCGAGCTGGTCACGTCCAAGACGGTATAT
GCCAAGATTGACCGGCCGGCGCGCGTCGTCAGCTTCGCCAAGCCGAGCAGCGCCGACGACGTGCTGAACGAATGG
AGCCACAACATGAAGAACCTGCTGGGTTTGCTGGAGAGGATCGACCACCTGATTACCAAGGAGGAGATGATGGCG
CGCATACAGCCGACGAGCGCAAAGTAG
Gene >Ophun1|7383
ATGTCCGAGGGAGCGCTGAAACCGGAGAAGGACTTCTCCAAGGATGTCGACCAGCAGCTTCCAGAGGCCGAAGCG
CTGGCAAAGGTCAGCAGCCGAAGCCGTTTCGATGACCGAGGTGCTGACGGGCTCTTCATAGACCAACCTTCAAGG
AGCCATCGAGAAGCTCACAGCGCTAGAGAAACAGACGCGTCAAGTCAGTTGCCGCTCCTCGCCTTGAAACCACCG
TTACCTCTCTGACTAGCGTCCCAGGCTTCGGATCTGGCGTCGACGTCGCGCGTCATAATAGCCATCGTCACCCTC
TGCAAAGATGCCGGCGACTGGAGCTTGATGAACGACCAGACGCTGGTTCTGTCCAAGAAGCACAGTCAGCTCAAG
CAGGCCATCACCAAGATGGTCCAAACCGTCGTTGGCTTCCTCGACGACACGCCCGACATCAAGACGAAGCTCTCT
GTCATCGACACGCTGCGGACGGTGACCGAGGGCAAGATATTCGTCGAGGTCGAGCGCGCTCGCGTCACCAAGATT
CTGTCGGATATGAAGAAGTCTCAAGGCGAACTCAAGGCCGCCACCGAGATTCTCTGCGAGCTGCAGGTCGAGACG
TTTGGCTCCATGGGTCGACGGGAGAAGACAGAGTTCATTCTGGCTCAGGTCGCTCTCTGCATTGAGAGCGGCGAC
TGGACGCAGGCCGGCATCTTGGCTCGCAAAATCAGCACCAAGTACCTGTCCCGCAAGCCCAAGAAGACGGCCGAG
GAACTGGAAAAGGCCAGACAGGAGCGCGAGAAGAAGAGGGGACCCGGCGAGGAGGAAGTCCGCGATGACTTGGAC
GATGATACGACGGATCTGAGGCTGCGCTACTACGAGCAGCAAATCATGCTTGCCAAGCACGAGGGCAAATATCTC
GACGTCTGCAAGCACTACCGGCAGGTTCTCGACACGGAGGCCGTGGAGGAGGATCCGGCCAAGCTTCATCCCGTA
CGTCCATGTCCACTGTGACCTTGGATGGCGCCGCCTCTGCTGACGTGGTCCCCCGAAAAGGTCCTTCAACGCATC
ATCTACTTTGCCATTCTCGCCCCTTACGACAACGAACAACACGACCTCCTGCACCGCATCCACCGCGATACGCGC
AACTCGCAAATCCCCATGGACGCCGAGCTCCTCCGCTTCTTCACCGTACACGAGCTGATGCGGTGGCCCGAGATT
GCCAACAAGTTTGGCCCGCACCTGTGCAGCACCGACGTCTTCGACTCCCAGGCAGGCCAGTCTTCGGACGACAAG
GCGCATCAGCGATGGGAGGATCTCCGGAAGCGCGTCATCGAGCACAACGTCCGCGTCGTGGCCAAGTATTACACG
CGCATCCAGATGAAGCGCCTGACGGAGCTCCTGGACCTGACGGAGGACGAGACGGAAAAGTACATTAGCGAGCTG
GTCACGTCCAAGACGGTATATGCCAAGATTGACCGGCCGGCGCGCGTCGTCAGCTTCGCCAAGCCGAGCAGCGCC
GACGACGTGCTGAACGAATGGAGCCACAACATGAAGAACCTGCTGGGTTTGCTGGAGAGGATCGACCACCTGATT
ACCAAGGAGGAGATGATGGCGCGCATACAGCCGACGAGCGCAAAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail