Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7375
Gene name
LocationContig_916:4783..5581
Strand-
Gene length (bp)798
Transcript length (bp)798
Coding sequence length (bp)798
Protein length (aa) 266

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01351 RNase_HII Ribonuclease HII 1.3E-31 1 208

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P5X8|RNH2A_NEUCR Ribonuclease H2 subunit A OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rnh-201 PE=3 SV=1 1 265 8.0E-90
sp|Q10236|RNH2A_SCHPO Ribonuclease H2 subunit A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rnh201 PE=3 SV=1 1 258 3.0E-60
sp|Q54D13|RNH2A_DICDI Ribonuclease H2 subunit A OS=Dictyostelium discoideum GN=rnaseh2A PE=3 SV=1 1 231 3.0E-40
sp|Q9U6P6|RNH2A_CAEEL Ribonuclease H2 subunit A OS=Caenorhabditis elegans GN=rnh-2 PE=2 SV=1 1 256 8.0E-38
sp|Q9VPP5|RNH2A_DROME Ribonuclease H2 subunit A OS=Drosophila melanogaster GN=CG13690 PE=2 SV=1 1 240 5.0E-37
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P5X8|RNH2A_NEUCR Ribonuclease H2 subunit A OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rnh-201 PE=3 SV=1 1 265 8.0E-90
sp|Q10236|RNH2A_SCHPO Ribonuclease H2 subunit A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rnh201 PE=3 SV=1 1 258 3.0E-60
sp|Q54D13|RNH2A_DICDI Ribonuclease H2 subunit A OS=Dictyostelium discoideum GN=rnaseh2A PE=3 SV=1 1 231 3.0E-40
sp|Q9U6P6|RNH2A_CAEEL Ribonuclease H2 subunit A OS=Caenorhabditis elegans GN=rnh-2 PE=2 SV=1 1 256 8.0E-38
sp|Q9VPP5|RNH2A_DROME Ribonuclease H2 subunit A OS=Drosophila melanogaster GN=CG13690 PE=2 SV=1 1 240 5.0E-37
sp|O75792|RNH2A_HUMAN Ribonuclease H2 subunit A OS=Homo sapiens GN=RNASEH2A PE=1 SV=2 1 241 1.0E-36
sp|Q2TBT5|RNH2A_BOVIN Ribonuclease H2 subunit A OS=Bos taurus GN=RNASEH2A PE=1 SV=1 1 214 3.0E-36
sp|Q9SEZ6|RNH2A_ARATH Ribonuclease H2 subunit A OS=Arabidopsis thaliana GN=At2g25100 PE=2 SV=2 1 250 4.0E-36
sp|Q9CWY8|RNH2A_MOUSE Ribonuclease H2 subunit A OS=Mus musculus GN=Rnaseh2a PE=1 SV=2 1 240 1.0E-35
sp|Q5U209|RNH2A_RAT Ribonuclease H2 subunit A OS=Rattus norvegicus GN=Rnaseh2a PE=2 SV=1 1 240 3.0E-35
sp|P53942|RNH2A_YEAST Ribonuclease H2 subunit A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RNH201 PE=1 SV=1 1 225 7.0E-35
sp|Q9V1A9|RNH2_PYRAB Ribonuclease HII OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rnhB PE=3 SV=1 25 224 4.0E-15
sp|O59351|RNH2_PYRHO Ribonuclease HII OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rnhB PE=1 SV=1 25 224 1.0E-14
sp|O74035|RNH2_THEKO Ribonuclease HII OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rnhB PE=1 SV=1 1 212 3.0E-13
sp|P57673|RNH2_THEAC Ribonuclease HII OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rnhB PE=3 SV=1 25 218 3.0E-13
sp|Q97CG6|RNH2_THEVO Ribonuclease HII OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rnhB PE=3 SV=2 15 223 2.0E-12
sp|A4FWE5|RNH2_METM5 Ribonuclease HII OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rnhB PE=3 SV=1 25 215 2.0E-12
sp|A9A9T9|RNH2_METM6 Ribonuclease HII OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rnhB PE=3 SV=1 22 215 2.0E-12
sp|Q8U036|RNH2_PYRFU Ribonuclease HII OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rnhB PE=3 SV=1 1 212 2.0E-12
sp|A6VGW0|RNH2_METM7 Ribonuclease HII OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rnhB PE=3 SV=1 22 215 5.0E-12
sp|Q9YET5|RNH2_AERPE Ribonuclease HII OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rnhB PE=3 SV=2 19 212 1.0E-11
sp|B6YVT5|RNH2_THEON Ribonuclease HII OS=Thermococcus onnurineus (strain NA1) GN=rnhB PE=3 SV=1 1 212 6.0E-11
sp|Q2NEI6|RNH2_METST Ribonuclease HII OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rnhB PE=3 SV=1 116 212 7.0E-11
sp|A1RYM0|RNH2_THEPD Ribonuclease HII OS=Thermofilum pendens (strain Hrk 5) GN=rnhB PE=3 SV=1 1 212 4.0E-10
sp|C6A1I4|RNH2_THESM Ribonuclease HII OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=rnhB PE=3 SV=1 1 243 5.0E-10
sp|A8MAH5|RNH2_CALMQ Ribonuclease HII OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=rnhB PE=3 SV=1 19 214 6.0E-10
sp|Q974Z3|RNH2_SULTO Ribonuclease HII OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rnhB PE=3 SV=1 25 212 1.0E-09
sp|Q2FP80|RNH2_METHJ Ribonuclease HII OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rnhB PE=3 SV=1 122 213 2.0E-09
sp|Q97W56|RNH2_SULSO Ribonuclease HII OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rnhB PE=3 SV=1 1 210 3.0E-09
sp|Q6LXH7|RNH2_METMP Ribonuclease HII OS=Methanococcus maripaludis (strain S2 / LL) GN=rnhB PE=3 SV=1 25 215 5.0E-09
sp|B1YB67|RNH2_PYRNV Ribonuclease HII OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=rnhB PE=3 SV=1 25 210 2.0E-08
sp|A7I9P7|RNH2_METB6 Ribonuclease HII OS=Methanoregula boonei (strain 6A8) GN=rnhB PE=3 SV=1 1 213 6.0E-08
sp|A2BL34|RNH2_HYPBU Ribonuclease HII OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=rnhB PE=3 SV=1 25 212 7.0E-08
sp|A2STJ6|RNH2_METLZ Ribonuclease HII OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=rnhB PE=3 SV=1 1 214 2.0E-07
sp|Q0W5R8|RNH2_METAR Ribonuclease HII OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=rnhB PE=3 SV=1 19 215 7.0E-07
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2091
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7852
Ophiocordyceps australis map64 (Brazil) OphauB2|6510
Ophiocordyceps camponoti-floridani Ophcf2|06603
Ophiocordyceps camponoti-rufipedis Ophun1|7375 (this protein)
Ophiocordyceps kimflemingae Ophio5|5806
Ophiocordyceps subramaniannii Hirsu2|2458

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7375
MVYAALVVPLSSSTQLLRESHAFDDSKALTPAVRNGLMRALCSSASDLFESCAWAVSVLSARDISAEMMRPAAPH
TLNAQAFDATVHLIRQLCEAGVNVREIYVDAVGPPVPYQIRLQRLFPTASVVVANKADSLFPCVSAASICAKVTR
DAALEHLYAAQRSPLESSSSPPSWGSGYPSDARCVTWMKTNMHPIFGWGPECRFSWSTAKDMLDDGKTGAVKVDW
PLPSDAHSSRVTDFFLPSADERASDELGSWFGTSVGVDAL*
Coding >Ophun1|7375
ATGGTGTACGCCGCGCTGGTGGTGCCTCTATCCTCATCGACGCAGCTTCTCCGCGAGTCGCACGCCTTTGACGAC
TCCAAGGCGCTGACGCCCGCTGTTCGCAACGGGTTGATGCGCGCGCTCTGCTCGTCTGCTTCGGACCTCTTCGAG
TCTTGCGCCTGGGCTGTTTCCGTGCTTTCGGCGAGGGATATCTCGGCTGAGATGATGAGGCCTGCTGCTCCGCAT
ACGCTCAATGCTCAGGCTTTTGACGCTACCGTTCATCTGATACGCCAGCTGTGCGAAGCCGGCGTCAACGTCCGT
GAAATATACGTCGATGCTGTCGGCCCTCCCGTTCCCTATCAGATCCGTCTGCAGCGGCTGTTCCCCACGGCGTCC
GTCGTTGTAGCCAACAAGGCCGATAGCCTCTTCCCTTGCGTCAGCGCCGCCTCCATATGCGCCAAAGTCACGCGC
GACGCCGCTCTCGAGCATCTCTACGCCGCCCAACGCTCGCCATTGGAATCGTCGTCGTCACCACCGTCTTGGGGT
TCGGGCTATCCCTCTGATGCTCGCTGCGTCACCTGGATGAAGACTAATATGCACCCCATCTTCGGCTGGGGTCCC
GAGTGTCGCTTCAGCTGGAGCACTGCAAAGGACATGCTCGACGACGGCAAGACCGGCGCCGTCAAGGTCGACTGG
CCGCTGCCTTCCGATGCTCACTCGAGCCGTGTCACCGACTTCTTTCTGCCAAGCGCCGACGAGAGGGCATCGGAT
GAGCTGGGCTCCTGGTTCGGCACCTCGGTTGGGGTTGACGCCTTGTAG
Transcript >Ophun1|7375
ATGGTGTACGCCGCGCTGGTGGTGCCTCTATCCTCATCGACGCAGCTTCTCCGCGAGTCGCACGCCTTTGACGAC
TCCAAGGCGCTGACGCCCGCTGTTCGCAACGGGTTGATGCGCGCGCTCTGCTCGTCTGCTTCGGACCTCTTCGAG
TCTTGCGCCTGGGCTGTTTCCGTGCTTTCGGCGAGGGATATCTCGGCTGAGATGATGAGGCCTGCTGCTCCGCAT
ACGCTCAATGCTCAGGCTTTTGACGCTACCGTTCATCTGATACGCCAGCTGTGCGAAGCCGGCGTCAACGTCCGT
GAAATATACGTCGATGCTGTCGGCCCTCCCGTTCCCTATCAGATCCGTCTGCAGCGGCTGTTCCCCACGGCGTCC
GTCGTTGTAGCCAACAAGGCCGATAGCCTCTTCCCTTGCGTCAGCGCCGCCTCCATATGCGCCAAAGTCACGCGC
GACGCCGCTCTCGAGCATCTCTACGCCGCCCAACGCTCGCCATTGGAATCGTCGTCGTCACCACCGTCTTGGGGT
TCGGGCTATCCCTCTGATGCTCGCTGCGTCACCTGGATGAAGACTAATATGCACCCCATCTTCGGCTGGGGTCCC
GAGTGTCGCTTCAGCTGGAGCACTGCAAAGGACATGCTCGACGACGGCAAGACCGGCGCCGTCAAGGTCGACTGG
CCGCTGCCTTCCGATGCTCACTCGAGCCGTGTCACCGACTTCTTTCTGCCAAGCGCCGACGAGAGGGCATCGGAT
GAGCTGGGCTCCTGGTTCGGCACCTCGGTTGGGGTTGACGCCTTGTAG
Gene >Ophun1|7375
ATGGTGTACGCCGCGCTGGTGGTGCCTCTATCCTCATCGACGCAGCTTCTCCGCGAGTCGCACGCCTTTGACGAC
TCCAAGGCGCTGACGCCCGCTGTTCGCAACGGGTTGATGCGCGCGCTCTGCTCGTCTGCTTCGGACCTCTTCGAG
TCTTGCGCCTGGGCTGTTTCCGTGCTTTCGGCGAGGGATATCTCGGCTGAGATGATGAGGCCTGCTGCTCCGCAT
ACGCTCAATGCTCAGGCTTTTGACGCTACCGTTCATCTGATACGCCAGCTGTGCGAAGCCGGCGTCAACGTCCGT
GAAATATACGTCGATGCTGTCGGCCCTCCCGTTCCCTATCAGATCCGTCTGCAGCGGCTGTTCCCCACGGCGTCC
GTCGTTGTAGCCAACAAGGCCGATAGCCTCTTCCCTTGCGTCAGCGCCGCCTCCATATGCGCCAAAGTCACGCGC
GACGCCGCTCTCGAGCATCTCTACGCCGCCCAACGCTCGCCATTGGAATCGTCGTCGTCACCACCGTCTTGGGGT
TCGGGCTATCCCTCTGATGCTCGCTGCGTCACCTGGATGAAGACTAATATGCACCCCATCTTCGGCTGGGGTCCC
GAGTGTCGCTTCAGCTGGAGCACTGCAAAGGACATGCTCGACGACGGCAAGACCGGCGCCGTCAAGGTCGACTGG
CCGCTGCCTTCCGATGCTCACTCGAGCCGTGTCACCGACTTCTTTCTGCCAAGCGCCGACGAGAGGGCATCGGAT
GAGCTGGGCTCCTGGTTCGGCACCTCGGTTGGGGTTGACGCCTTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail