Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7373
Gene name
LocationContig_915:2181..4729
Strand-
Gene length (bp)2548
Transcript length (bp)2496
Coding sequence length (bp)2496
Protein length (aa) 832

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF19343 DUF5923 Family of unknown function (DUF5923) 1.6E-243 3 612
PF14613 DUF4449 Protein of unknown function (DUF4449) 2.2E-65 624 786

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q10327|YD72_SCHPO Uncharacterized protein C32A11.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC32A11.02c PE=4 SV=1 8 776 4.0E-85

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2326
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3392
Ophiocordyceps australis map64 (Brazil) OphauB2|5783
Ophiocordyceps camponoti-floridani Ophcf2|05974
Ophiocordyceps camponoti-rufipedis Ophun1|7373 (this protein)
Ophiocordyceps kimflemingae Ophio5|3447
Ophiocordyceps subramaniannii Hirsu2|3159

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7373
MAANVNKPTDSKQKEADINRKLQLYGIFSAFQLGKVPSNDQIDVALNSFLASKALSEPDPKLSDDGKLLVKDTRE
MVEKAQHLILSKNEGNLIQDFIWQTTQFDAKSIHGPDRPIDKDGLKRDGDETLKGLRTLGTLLITNGQFRKLLKD
ASVLLRDMAGDAASNAATFVRPSEDQLAQLDTAAPDNTWYDAPDLSKESLKKQAQNIYGGNAKNDAQDVAAAGTN
AAAPVGTSDPRAADRTAGQNAVVSAAKQKIDQNLDPETKEKIKKRNEEYRNKAKVYFEKKMPQERKEQIIFRLKK
MILECQQHQDYSEAIQTILRLAETYGRHGRSMGEGSAGSAKKARSGFAAAENDLRTLIERFANGTSTSELWASIH
KIYEAAEKDQDLKGWFKAMNNYIRRCLLEQGYILDEASTREWDRLYDHGRYLLRDKYRHQTDDVIGEVKFIADQF
DQDVHNKAFGKSVEQIFDHLGHDSTGKSAFKPHLLKDLGEVIVPTLLQNINYIPIPRIEYVDPQFEVAIENLVLE
SDNFMPNVFEIASENFFRWGRKNAGNKNHNMIDVKVSGIQMDLRDVSYYVRRKSGFPAISDLGVADILLPGNGLS
FRMKVSTADKTDRQNFFKVNKVDVDFKGLNIRLKQSRHKLLFALVKPLMLTILRPPIQKAVEKAIKDQCNKLDAE
MYQIKQEADRAAKEGQTDAEKQENFYKRYYQAAQKRFLEGKEKKKEEAKEVAEDKKVNIAMTMEDSILPDVKLPG
GVSLKATEYKELARKGEKWESPVFSIGSAKKSTSVPSAPRIEKKTRPPPTPKATNGRPAVVNGKAPVANVNLPGQ
PQLGAY*
Coding >Ophun1|7373
ATGGCTGCCAACGTCAACAAGCCCACCGACTCCAAACAGAAGGAGGCCGACATCAACCGCAAGTTGCAGCTCTAT
GGCATCTTCAGCGCCTTTCAGCTCGGCAAGGTGCCCTCGAACGATCAAATCGATGTCGCCCTCAACAGCTTCCTC
GCCTCAAAGGCCCTCAGTGAACCCGATCCCAAACTGTCCGACGATGGAAAGCTGCTTGTCAAGGATACGCGCGAG
ATGGTCGAAAAGGCCCAGCACCTGATCCTGTCCAAGAACGAGGGCAACCTCATTCAAGACTTCATCTGGCAAACC
ACTCAATTTGACGCAAAGAGCATCCACGGCCCCGACCGTCCCATCGACAAGGATGGCCTCAAGCGCGATGGCGAC
GAGACGCTCAAGGGTCTGAGGACGCTCGGTACGCTGCTCATTACCAATGGCCAGTTCCGCAAGCTGCTCAAGGAC
GCATCCGTTCTCCTCCGCGACATGGCCGGAGACGCCGCCAGCAACGCCGCCACCTTTGTCCGTCCTTCAGAGGAC
CAGCTCGCTCAGTTGGACACGGCTGCGCCCGACAACACCTGGTACGACGCCCCTGACCTGTCCAAGGAAAGCCTC
AAGAAGCAGGCCCAGAACATCTACGGTGGAAACGCCAAGAATGATGCGCAGGACGTCGCCGCTGCTGGCACCAAC
GCCGCTGCCCCCGTCGGCACTTCGGATCCCCGGGCTGCCGATAGGACGGCCGGCCAGAACGCCGTCGTGTCCGCT
GCCAAGCAAAAGATTGATCAGAATCTCGATCCCGAGACCAAGGAGAAGATCAAGAAGCGCAACGAAGAGTATCGC
AACAAGGCCAAGGTCTACTTCGAGAAGAAGATGCCTCAGGAACGCAAGGAGCAGATCATCTTCCGTCTCAAGAAG
ATGATCCTCGAGTGCCAGCAACATCAGGACTACTCCGAGGCCATCCAGACGATCCTCAGACTCGCCGAGACGTAT
GGCCGCCACGGTCGCTCCATGGGCGAGGGATCTGCCGGTTCGGCCAAGAAGGCTCGTTCCGGCTTCGCTGCTGCC
GAGAACGATCTTCGCACCCTCATTGAGCGCTTTGCCAACGGCACCTCTACGTCGGAGTTATGGGCGTCGATCCAC
AAGATCTACGAGGCTGCCGAAAAGGACCAGGATCTCAAGGGCTGGTTCAAGGCCATGAACAACTACATCCGCCGC
TGCCTGCTCGAGCAGGGCTACATCCTCGACGAGGCGTCGACGAGGGAGTGGGACCGCCTCTACGACCACGGCCGT
TACCTCCTCCGCGACAAGTATCGTCACCAGACGGACGACGTCATTGGCGAGGTCAAGTTCATCGCCGACCAGTTT
GATCAGGACGTGCACAACAAGGCCTTTGGCAAGTCGGTCGAGCAGATCTTTGACCACTTGGGCCACGACTCGACT
GGCAAGTCGGCCTTTAAGCCCCATCTCCTCAAGGATCTCGGCGAGGTGATTGTGCCCACGCTGCTGCAGAACATC
AACTACATCCCCATCCCTCGCATCGAGTACGTGGATCCTCAGTTCGAAGTCGCCATTGAGAACCTGGTGCTGGAG
AGCGACAACTTCATGCCCAACGTCTTTGAGATTGCCAGCGAGAACTTCTTCCGCTGGGGCCGCAAGAATGCCGGC
AACAAGAATCACAACATGATTGACGTCAAGGTCTCGGGCATCCAGATGGACCTCCGCGATGTCAGCTACTACGTC
AGGCGCAAGTCGGGCTTCCCTGCCATCAGCGACCTGGGCGTGGCCGACATCCTCCTCCCCGGCAACGGCCTCTCG
TTCCGCATGAAGGTGTCGACGGCCGACAAGACGGACCGACAGAACTTCTTCAAGGTCAACAAGGTCGACGTCGAC
TTCAAGGGCCTCAACATCAGGCTCAAGCAGTCGCGCCACAAGTTGCTCTTCGCCCTCGTCAAGCCGCTGATGCTC
ACCATCCTGCGCCCGCCCATCCAGAAGGCGGTGGAGAAGGCCATCAAGGACCAGTGCAACAAGCTGGACGCCGAG
ATGTACCAGATCAAGCAGGAGGCCGACCGGGCCGCCAAGGAGGGCCAGACGGACGCGGAGAAGCAGGAGAACTTT
TACAAGCGCTACTACCAGGCGGCGCAGAAGCGCTTCCTCGAGGGCAAGGAGAAGAAGAAGGAGGAAGCCAAGGAG
GTGGCCGAGGACAAGAAGGTCAACATCGCCATGACGATGGAGGACAGCATCCTGCCGGACGTGAAGCTCCCGGGC
GGCGTGAGCCTCAAGGCGACCGAGTACAAGGAGCTGGCGCGCAAGGGCGAGAAGTGGGAGAGTCCCGTCTTCTCC
ATCGGCAGCGCCAAGAAGAGCACCAGCGTGCCGTCGGCGCCTCGCATCGAGAAGAAGACGCGACCGCCGCCGACG
CCCAAGGCGACCAACGGCCGGCCGGCGGTTGTCAACGGAAAGGCGCCGGTGGCCAATGTCAACCTGCCGGGACAG
CCGCAGCTCGGCGCCTACTAG
Transcript >Ophun1|7373
ATGGCTGCCAACGTCAACAAGCCCACCGACTCCAAACAGAAGGAGGCCGACATCAACCGCAAGTTGCAGCTCTAT
GGCATCTTCAGCGCCTTTCAGCTCGGCAAGGTGCCCTCGAACGATCAAATCGATGTCGCCCTCAACAGCTTCCTC
GCCTCAAAGGCCCTCAGTGAACCCGATCCCAAACTGTCCGACGATGGAAAGCTGCTTGTCAAGGATACGCGCGAG
ATGGTCGAAAAGGCCCAGCACCTGATCCTGTCCAAGAACGAGGGCAACCTCATTCAAGACTTCATCTGGCAAACC
ACTCAATTTGACGCAAAGAGCATCCACGGCCCCGACCGTCCCATCGACAAGGATGGCCTCAAGCGCGATGGCGAC
GAGACGCTCAAGGGTCTGAGGACGCTCGGTACGCTGCTCATTACCAATGGCCAGTTCCGCAAGCTGCTCAAGGAC
GCATCCGTTCTCCTCCGCGACATGGCCGGAGACGCCGCCAGCAACGCCGCCACCTTTGTCCGTCCTTCAGAGGAC
CAGCTCGCTCAGTTGGACACGGCTGCGCCCGACAACACCTGGTACGACGCCCCTGACCTGTCCAAGGAAAGCCTC
AAGAAGCAGGCCCAGAACATCTACGGTGGAAACGCCAAGAATGATGCGCAGGACGTCGCCGCTGCTGGCACCAAC
GCCGCTGCCCCCGTCGGCACTTCGGATCCCCGGGCTGCCGATAGGACGGCCGGCCAGAACGCCGTCGTGTCCGCT
GCCAAGCAAAAGATTGATCAGAATCTCGATCCCGAGACCAAGGAGAAGATCAAGAAGCGCAACGAAGAGTATCGC
AACAAGGCCAAGGTCTACTTCGAGAAGAAGATGCCTCAGGAACGCAAGGAGCAGATCATCTTCCGTCTCAAGAAG
ATGATCCTCGAGTGCCAGCAACATCAGGACTACTCCGAGGCCATCCAGACGATCCTCAGACTCGCCGAGACGTAT
GGCCGCCACGGTCGCTCCATGGGCGAGGGATCTGCCGGTTCGGCCAAGAAGGCTCGTTCCGGCTTCGCTGCTGCC
GAGAACGATCTTCGCACCCTCATTGAGCGCTTTGCCAACGGCACCTCTACGTCGGAGTTATGGGCGTCGATCCAC
AAGATCTACGAGGCTGCCGAAAAGGACCAGGATCTCAAGGGCTGGTTCAAGGCCATGAACAACTACATCCGCCGC
TGCCTGCTCGAGCAGGGCTACATCCTCGACGAGGCGTCGACGAGGGAGTGGGACCGCCTCTACGACCACGGCCGT
TACCTCCTCCGCGACAAGTATCGTCACCAGACGGACGACGTCATTGGCGAGGTCAAGTTCATCGCCGACCAGTTT
GATCAGGACGTGCACAACAAGGCCTTTGGCAAGTCGGTCGAGCAGATCTTTGACCACTTGGGCCACGACTCGACT
GGCAAGTCGGCCTTTAAGCCCCATCTCCTCAAGGATCTCGGCGAGGTGATTGTGCCCACGCTGCTGCAGAACATC
AACTACATCCCCATCCCTCGCATCGAGTACGTGGATCCTCAGTTCGAAGTCGCCATTGAGAACCTGGTGCTGGAG
AGCGACAACTTCATGCCCAACGTCTTTGAGATTGCCAGCGAGAACTTCTTCCGCTGGGGCCGCAAGAATGCCGGC
AACAAGAATCACAACATGATTGACGTCAAGGTCTCGGGCATCCAGATGGACCTCCGCGATGTCAGCTACTACGTC
AGGCGCAAGTCGGGCTTCCCTGCCATCAGCGACCTGGGCGTGGCCGACATCCTCCTCCCCGGCAACGGCCTCTCG
TTCCGCATGAAGGTGTCGACGGCCGACAAGACGGACCGACAGAACTTCTTCAAGGTCAACAAGGTCGACGTCGAC
TTCAAGGGCCTCAACATCAGGCTCAAGCAGTCGCGCCACAAGTTGCTCTTCGCCCTCGTCAAGCCGCTGATGCTC
ACCATCCTGCGCCCGCCCATCCAGAAGGCGGTGGAGAAGGCCATCAAGGACCAGTGCAACAAGCTGGACGCCGAG
ATGTACCAGATCAAGCAGGAGGCCGACCGGGCCGCCAAGGAGGGCCAGACGGACGCGGAGAAGCAGGAGAACTTT
TACAAGCGCTACTACCAGGCGGCGCAGAAGCGCTTCCTCGAGGGCAAGGAGAAGAAGAAGGAGGAAGCCAAGGAG
GTGGCCGAGGACAAGAAGGTCAACATCGCCATGACGATGGAGGACAGCATCCTGCCGGACGTGAAGCTCCCGGGC
GGCGTGAGCCTCAAGGCGACCGAGTACAAGGAGCTGGCGCGCAAGGGCGAGAAGTGGGAGAGTCCCGTCTTCTCC
ATCGGCAGCGCCAAGAAGAGCACCAGCGTGCCGTCGGCGCCTCGCATCGAGAAGAAGACGCGACCGCCGCCGACG
CCCAAGGCGACCAACGGCCGGCCGGCGGTTGTCAACGGAAAGGCGCCGGTGGCCAATGTCAACCTGCCGGGACAG
CCGCAGCTCGGCGCCTACTAG
Gene >Ophun1|7373
ATGGCTGCCAACGTCAACAAGCCCACCGACTCCAAACAGAAGGAGGCCGACATCAACCGCAAGTTGCAGCTCTAT
GGCATCTTCAGCGCCTTTCAGCTCGGCAAGGTGCCCTCGGTTTGTCGTCCCTCTCCTTGCCACCCTTTTGGTGTG
CGCTGACAACTTGCAGAACGATCAAATCGATGTCGCCCTCAACAGCTTCCTCGCCTCAAAGGCCCTCAGTGAACC
CGATCCCAAACTGTCCGACGATGGAAAGCTGCTTGTCAAGGATACGCGCGAGATGGTCGAAAAGGCCCAGCACCT
GATCCTGTCCAAGAACGAGGGCAACCTCATTCAAGACTTCATCTGGCAAACCACTCAATTTGACGCAAAGAGCAT
CCACGGCCCCGACCGTCCCATCGACAAGGATGGCCTCAAGCGCGATGGCGACGAGACGCTCAAGGGTCTGAGGAC
GCTCGGTACGCTGCTCATTACCAATGGCCAGTTCCGCAAGCTGCTCAAGGACGCATCCGTTCTCCTCCGCGACAT
GGCCGGAGACGCCGCCAGCAACGCCGCCACCTTTGTCCGTCCTTCAGAGGACCAGCTCGCTCAGTTGGACACGGC
TGCGCCCGACAACACCTGGTACGACGCCCCTGACCTGTCCAAGGAAAGCCTCAAGAAGCAGGCCCAGAACATCTA
CGGTGGAAACGCCAAGAATGATGCGCAGGACGTCGCCGCTGCTGGCACCAACGCCGCTGCCCCCGTCGGCACTTC
GGATCCCCGGGCTGCCGATAGGACGGCCGGCCAGAACGCCGTCGTGTCCGCTGCCAAGCAAAAGATTGATCAGAA
TCTCGATCCCGAGACCAAGGAGAAGATCAAGAAGCGCAACGAAGAGTATCGCAACAAGGCCAAGGTCTACTTCGA
GAAGAAGATGCCTCAGGAACGCAAGGAGCAGATCATCTTCCGTCTCAAGAAGATGATCCTCGAGTGCCAGCAACA
TCAGGACTACTCCGAGGCCATCCAGACGATCCTCAGACTCGCCGAGACGTATGGCCGCCACGGTCGCTCCATGGG
CGAGGGATCTGCCGGTTCGGCCAAGAAGGCTCGTTCCGGCTTCGCTGCTGCCGAGAACGATCTTCGCACCCTCAT
TGAGCGCTTTGCCAACGGCACCTCTACGTCGGAGTTATGGGCGTCGATCCACAAGATCTACGAGGCTGCCGAAAA
GGACCAGGATCTCAAGGGCTGGTTCAAGGCCATGAACAACTACATCCGCCGCTGCCTGCTCGAGCAGGGCTACAT
CCTCGACGAGGCGTCGACGAGGGAGTGGGACCGCCTCTACGACCACGGCCGTTACCTCCTCCGCGACAAGTATCG
TCACCAGACGGACGACGTCATTGGCGAGGTCAAGTTCATCGCCGACCAGTTTGATCAGGACGTGCACAACAAGGC
CTTTGGCAAGTCGGTCGAGCAGATCTTTGACCACTTGGGCCACGACTCGACTGGCAAGTCGGCCTTTAAGCCCCA
TCTCCTCAAGGATCTCGGCGAGGTGATTGTGCCCACGCTGCTGCAGAACATCAACTACATCCCCATCCCTCGCAT
CGAGTACGTGGATCCTCAGTTCGAAGTCGCCATTGAGAACCTGGTGCTGGAGAGCGACAACTTCATGCCCAACGT
CTTTGAGATTGCCAGCGAGAACTTCTTCCGCTGGGGCCGCAAGAATGCCGGCAACAAGAATCACAACATGATTGA
CGTCAAGGTCTCGGGCATCCAGATGGACCTCCGCGATGTCAGCTACTACGTCAGGCGCAAGTCGGGCTTCCCTGC
CATCAGCGACCTGGGCGTGGCCGACATCCTCCTCCCCGGCAACGGCCTCTCGTTCCGCATGAAGGTGTCGACGGC
CGACAAGACGGACCGACAGAACTTCTTCAAGGTCAACAAGGTCGACGTCGACTTCAAGGGCCTCAACATCAGGCT
CAAGCAGTCGCGCCACAAGTTGCTCTTCGCCCTCGTCAAGCCGCTGATGCTCACCATCCTGCGCCCGCCCATCCA
GAAGGCGGTGGAGAAGGCCATCAAGGACCAGTGCAACAAGCTGGACGCCGAGATGTACCAGATCAAGCAGGAGGC
CGACCGGGCCGCCAAGGAGGGCCAGACGGACGCGGAGAAGCAGGAGAACTTTTACAAGCGCTACTACCAGGCGGC
GCAGAAGCGCTTCCTCGAGGGCAAGGAGAAGAAGAAGGAGGAAGCCAAGGAGGTGGCCGAGGACAAGAAGGTCAA
CATCGCCATGACGATGGAGGACAGCATCCTGCCGGACGTGAAGCTCCCGGGCGGCGTGAGCCTCAAGGCGACCGA
GTACAAGGAGCTGGCGCGCAAGGGCGAGAAGTGGGAGAGTCCCGTCTTCTCCATCGGCAGCGCCAAGAAGAGCAC
CAGCGTGCCGTCGGCGCCTCGCATCGAGAAGAAGACGCGACCGCCGCCGACGCCCAAGGCGACCAACGGCCGGCC
GGCGGTTGTCAACGGAAAGGCGCCGGTGGCCAATGTCAACCTGCCGGGACAGCCGCAGCTCGGCGCCTACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail