Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|737
Gene name
LocationContig_1248:287..2762
Strand+
Gene length (bp)2475
Transcript length (bp)2220
Coding sequence length (bp)2220
Protein length (aa) 740

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q12324|YVC1_YEAST Calcium channel YVC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YVC1 PE=1 SV=2 203 573 2.0E-16
sp|Q5A2J7|YVC1_CANAL Calcium channel YVC1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=YVC1 PE=2 SV=1 116 646 2.0E-15

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 278 297 19
2 310 329 19
3 339 361 22
4 374 393 19
5 408 430 22
6 463 485 22
7 521 543 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|737
MADRRRRIITLPPQPPPRSSSPPPSPPLPPLSLTTERQPLLSRVPRGSDHGEDQVYSCMSNPHSHLPVYTNIHRI
RRDITSVVEDYLSLEQLRDVRINVTVIRPLVDKFYELGDVSIVYCLLVNRAQFLMEESQLSNRQNVNWSRATLCE
LIATRILRRFGEDYDGTEGLLLLAHVLVAGFHPFQNAPPDIQPEVPRKHHRTLPALELAIITESKHFLSSSTCER
VVTAIYDGRIIYTPSTFWDIIPDHYKLKPISLYDPRESPLLNQYRLIVPRNRTILEAIQFTILLGLYVGVMLRRD
KNSFTSLESVFAVYAFGWGLDQLATILAHGWDVYTQNLWSFLDVTFTCIFSVYLVIRLHGLRLGGSVYAQQAFDV
LALAAPVLVPRLAFILMSDNLIFLSLRSMMADFFMLTVLSAWCFFGFLLSLLWLGDGVHPLVTISKWMIYIWFGL
DGTGIQRSTEFHWLYGPCIMIAFAFLGNTLFLTILVSMLSNTFSNISTNATAEMQFRRAVLTLEGVKADAIFAYQ
PPFNLLAVFILLPLKFVVSPRWFHKTHVTMVRLVNLPLLLIIAVAERRLLWPAGGQKAVKPTKRRRLWRKWQMTT
HRDIRQVFIVPPPDDVHDDIAVDDDLTHHLIRRQFTRQPTTTMMTTTTETQSRKPSRRDSMFPGLASKLRGSFAE
DSEEQGAVAARVEAMEKSLKRMEGMLSRLVPDDSASSSSSSDGGASSLKDGDGLTMESSSRGQL*
Coding >Ophun1|737
ATGGCCGATCGCAGGCGGCGGATCATCACCTTACCGCCTCAGCCTCCGCCGCGATCCTCGTCTCCTCCACCGTCT
CCTCCTCTTCCTCCCCTCTCCCTCACCACAGAGCGCCAGCCGCTTCTCAGCAGAGTTCCTCGTGGAAGCGATCAT
GGCGAGGATCAGGTCTACAGCTGCATGTCGAATCCGCACAGCCACCTGCCCGTCTACACCAACATCCATCGCATC
CGGCGTGACATCACCAGCGTCGTTGAGGACTATCTTAGTCTCGAGCAGCTACGCGATGTTCGCATAAACGTCACC
GTCATCCGGCCTCTGGTCGACAAGTTCTACGAGCTCGGAGACGTCTCAATTGTCTACTGCCTGCTGGTCAACCGC
GCCCAGTTTCTGATGGAGGAATCTCAGTTGAGCAATCGGCAAAACGTCAACTGGTCGCGCGCAACCCTCTGCGAG
CTCATCGCCACCCGCATTCTCAGACGCTTCGGCGAGGACTATGACGGCACAGAGGGCCTGCTGCTTCTGGCTCAT
GTGCTCGTCGCGGGCTTCCATCCCTTTCAGAACGCTCCGCCAGATATCCAGCCCGAGGTCCCCCGAAAGCATCAT
CGCACTCTGCCGGCCCTCGAGCTGGCCATCATCACCGAGAGCAAGCATTTCCTCAGCTCTTCGACCTGCGAGCGC
GTCGTCACAGCCATCTACGATGGTCGCATCATCTACACGCCCTCGACCTTTTGGGACATCATCCCCGACCACTAC
AAGCTCAAACCAATCTCTCTCTACGACCCGCGCGAGTCGCCCCTGTTGAACCAGTATCGTCTGATTGTGCCACGC
AACCGCACCATCCTCGAGGCCATTCAGTTCACCATCCTGCTGGGCCTATACGTGGGCGTAATGCTACGGCGTGAC
AAGAACAGCTTCACTTCTCTGGAGTCCGTCTTCGCCGTCTACGCCTTTGGCTGGGGGCTGGATCAGCTGGCCACC
ATTCTGGCCCACGGCTGGGATGTGTACACCCAGAACCTGTGGTCCTTTCTCGACGTCACCTTTACGTGTATCTTC
TCCGTCTACCTCGTCATCCGCCTCCACGGCCTGCGATTGGGCGGCTCCGTCTACGCACAGCAGGCCTTTGACGTC
TTGGCGCTGGCTGCACCCGTCCTGGTGCCTCGACTGGCCTTTATCCTCATGTCGGACAATTTGATCTTTCTGTCT
CTGCGGTCCATGATGGCCGACTTCTTCATGTTGACCGTCCTGTCTGCCTGGTGCTTCTTTGGGTTCCTGCTGTCG
CTGCTATGGTTAGGGGACGGTGTTCATCCTCTTGTCACGATATCCAAGTGGATGATATACATTTGGTTCGGCCTC
GACGGCACCGGGATCCAACGCTCGACCGAGTTCCATTGGCTGTACGGACCCTGCATCATGATCGCCTTTGCCTTT
CTCGGCAACACTCTCTTCCTCACCATCCTCGTCTCGATGCTGTCCAACACGTTCAGCAACATCTCGACCAATGCC
ACGGCGGAGATGCAGTTCCGGCGGGCGGTTCTGACGCTCGAGGGCGTCAAGGCCGACGCCATCTTCGCCTACCAG
CCGCCCTTTAACCTGCTGGCCGTCTTCATCTTGCTGCCGCTCAAGTTCGTCGTCAGCCCCCGCTGGTTTCACAAG
ACACACGTGACGATGGTGCGGCTGGTGAACCTCCCGTTGCTGCTCATCATCGCCGTGGCCGAGCGGCGTCTGCTA
TGGCCGGCGGGCGGGCAGAAGGCGGTCAAGCCTACCAAGAGGAGAAGGCTTTGGCGCAAATGGCAGATGACGACG
CACAGGGACATCCGCCAAGTGTTTATCGTGCCGCCGCCCGACGACGTGCACGATGACATCGCCGTAGACGATGAC
TTGACGCACCACCTCATCCGGCGTCAATTCACACGACAGCCGACGACGACGATGATGACGACGACGACGGAGACG
CAGTCACGGAAGCCCTCGCGCAGGGACTCGATGTTCCCGGGCCTCGCCAGCAAGCTGCGCGGCTCCTTTGCCGAG
GATAGCGAGGAGCAGGGGGCGGTGGCGGCGAGGGTGGAAGCGATGGAGAAGTCGCTGAAGCGGATGGAGGGCATG
CTTTCGAGGCTGGTTCCGGATGACTCGGCCTCTTCGTCTTCATCGTCAGACGGAGGAGCCAGCAGTCTCAAGGAC
GGAGACGGGCTGACGATGGAGTCGAGCTCGAGGGGGCAGTTGTAG
Transcript >Ophun1|737
ATGGCCGATCGCAGGCGGCGGATCATCACCTTACCGCCTCAGCCTCCGCCGCGATCCTCGTCTCCTCCACCGTCT
CCTCCTCTTCCTCCCCTCTCCCTCACCACAGAGCGCCAGCCGCTTCTCAGCAGAGTTCCTCGTGGAAGCGATCAT
GGCGAGGATCAGGTCTACAGCTGCATGTCGAATCCGCACAGCCACCTGCCCGTCTACACCAACATCCATCGCATC
CGGCGTGACATCACCAGCGTCGTTGAGGACTATCTTAGTCTCGAGCAGCTACGCGATGTTCGCATAAACGTCACC
GTCATCCGGCCTCTGGTCGACAAGTTCTACGAGCTCGGAGACGTCTCAATTGTCTACTGCCTGCTGGTCAACCGC
GCCCAGTTTCTGATGGAGGAATCTCAGTTGAGCAATCGGCAAAACGTCAACTGGTCGCGCGCAACCCTCTGCGAG
CTCATCGCCACCCGCATTCTCAGACGCTTCGGCGAGGACTATGACGGCACAGAGGGCCTGCTGCTTCTGGCTCAT
GTGCTCGTCGCGGGCTTCCATCCCTTTCAGAACGCTCCGCCAGATATCCAGCCCGAGGTCCCCCGAAAGCATCAT
CGCACTCTGCCGGCCCTCGAGCTGGCCATCATCACCGAGAGCAAGCATTTCCTCAGCTCTTCGACCTGCGAGCGC
GTCGTCACAGCCATCTACGATGGTCGCATCATCTACACGCCCTCGACCTTTTGGGACATCATCCCCGACCACTAC
AAGCTCAAACCAATCTCTCTCTACGACCCGCGCGAGTCGCCCCTGTTGAACCAGTATCGTCTGATTGTGCCACGC
AACCGCACCATCCTCGAGGCCATTCAGTTCACCATCCTGCTGGGCCTATACGTGGGCGTAATGCTACGGCGTGAC
AAGAACAGCTTCACTTCTCTGGAGTCCGTCTTCGCCGTCTACGCCTTTGGCTGGGGGCTGGATCAGCTGGCCACC
ATTCTGGCCCACGGCTGGGATGTGTACACCCAGAACCTGTGGTCCTTTCTCGACGTCACCTTTACGTGTATCTTC
TCCGTCTACCTCGTCATCCGCCTCCACGGCCTGCGATTGGGCGGCTCCGTCTACGCACAGCAGGCCTTTGACGTC
TTGGCGCTGGCTGCACCCGTCCTGGTGCCTCGACTGGCCTTTATCCTCATGTCGGACAATTTGATCTTTCTGTCT
CTGCGGTCCATGATGGCCGACTTCTTCATGTTGACCGTCCTGTCTGCCTGGTGCTTCTTTGGGTTCCTGCTGTCG
CTGCTATGGTTAGGGGACGGTGTTCATCCTCTTGTCACGATATCCAAGTGGATGATATACATTTGGTTCGGCCTC
GACGGCACCGGGATCCAACGCTCGACCGAGTTCCATTGGCTGTACGGACCCTGCATCATGATCGCCTTTGCCTTT
CTCGGCAACACTCTCTTCCTCACCATCCTCGTCTCGATGCTGTCCAACACGTTCAGCAACATCTCGACCAATGCC
ACGGCGGAGATGCAGTTCCGGCGGGCGGTTCTGACGCTCGAGGGCGTCAAGGCCGACGCCATCTTCGCCTACCAG
CCGCCCTTTAACCTGCTGGCCGTCTTCATCTTGCTGCCGCTCAAGTTCGTCGTCAGCCCCCGCTGGTTTCACAAG
ACACACGTGACGATGGTGCGGCTGGTGAACCTCCCGTTGCTGCTCATCATCGCCGTGGCCGAGCGGCGTCTGCTA
TGGCCGGCGGGCGGGCAGAAGGCGGTCAAGCCTACCAAGAGGAGAAGGCTTTGGCGCAAATGGCAGATGACGACG
CACAGGGACATCCGCCAAGTGTTTATCGTGCCGCCGCCCGACGACGTGCACGATGACATCGCCGTAGACGATGAC
TTGACGCACCACCTCATCCGGCGTCAATTCACACGACAGCCGACGACGACGATGATGACGACGACGACGGAGACG
CAGTCACGGAAGCCCTCGCGCAGGGACTCGATGTTCCCGGGCCTCGCCAGCAAGCTGCGCGGCTCCTTTGCCGAG
GATAGCGAGGAGCAGGGGGCGGTGGCGGCGAGGGTGGAAGCGATGGAGAAGTCGCTGAAGCGGATGGAGGGCATG
CTTTCGAGGCTGGTTCCGGATGACTCGGCCTCTTCGTCTTCATCGTCAGACGGAGGAGCCAGCAGTCTCAAGGAC
GGAGACGGGCTGACGATGGAGTCGAGCTCGAGGGGGCAGTTGTAG
Gene >Ophun1|737
ATGGCCGATCGCAGGCGGCGGATCATCACCTTACCGCCTCAGCCTCCGCCGCGATCCTCGTCTCCTCCACCGTCT
CCTCCTCTTCCTCCCCTCTCCCTCACCACAGAGCGCCAGCCGCTTCTCAGCAGAGTTCCTCGTGGAAGCGATCAT
GGCGAGGATCAGGTCTACAGCTGCATGTCGAATCCGCACAGCCACCTGCCCGTCTACACCAACATCCATCGCATC
CGGCGTGACATCACCAGCGTCGTTGAGGACTATCTTAGTCTCGAGCAGCTACGCGATGTTCGCATAAACGTCACC
GTCATCCGGCCTCTGGTCGACAAGTTCTACGAGCTCGGAGACGTCTCAATTGGTGAGCAGCCCTTCCTTAATTCT
CCTCGTGTCGTCCAGACGGTTGACGACACTCTTCCCTTTTCGTCTTCCCTATTCAAAAAGTCTACTGCCTGCTGG
TCAACCGCGCCCAGTTTCTGATGGAGGAATCTCAGTTGAGCAATCGGCAAAACGTCAACTGGTCGCGCGCAACCC
TCTGCGAGCTCATCGCCACCCGCATTCTCAGACGCTTCGGCGAGGACTATGACGGCACAGAGGGCCTGCTGCTTC
TGGCTCATGTGCTCGTCGCGGGCTTCCATCCCTTTCAGAACGCTCCGCCAGATATCCAGCCCGAGGTCCCCCGAA
AGCATCATCGCACTCTGCCGGCCCTCGAGCTGGCCATCATCACCGAGAGCAAGCATTTCCTCAGCTCTTCGACCT
GCGAGCGCGTCGTCACAGCCATCTACGATGGTCGCATCATCTACACGCCCTCGACCTTTTGGGACATCATCCCCG
ACCACTACAAGCTCAAACCAATCTCTCTCTACGACCCGCGCGAGTCGCCCCTGTTGAACCAGTATCGTCTGATTG
TGCCACGCAACCGCACCATCCTCGAGGCCATTCAGTTCACCATCCTGCTGGGCCTATACGTGGGCGTAATGCTAC
GGCGTGACAAGAACAGCTTCACTTCTCTGGAGTCCGTCTTCGCCGTCTACGCCTTTGGCTGGGGGCTGGATCAGC
TGGCCACCATTCTGGCCCACGGCTGGTGAGTCCTTGACCCCTTGGGAGGCCCTGTGAAGCTTCTCTGATTGCCGG
ATGATGCAGGGATGTGTACACCCAGAACCTGTGGTCCTTTCTCGACGTCACCTTTACGTGTATCTTCTCCGTCTA
CCTCGTCATCCGCCTCCACGGCCTGCGATTGGGCGGCTCCGTCTACGCACAGCAGGCCTTTGACGTCTTGGCGCT
GGCTGCACCCGTCCTGGTGCCTCGACTGGCCTTTATCCTCATGTCGGACAATTTGATCTTTCTGTCTCTGCGGTC
CATGATGGCCGACTTCTTCATGTTGACCGTCCTGTCTGCCTGGTGCTTCTTTGGGTTCCTGCTGTCGCTGCTATG
GTTAGGGGACGGTGTTCATCCTCTTGTGTGAGTTTCTCGTCGGTCGTCTCGAAAGAGCTGAACTGACAGTCGGGT
TTCAAGCACGATATCCAAGTGGATGATATACATTTGGTTCGGCCTCGACGGCACCGGGATCCAACGCTCGGTAAG
CAGATGTCCTTCCATGGTTTCTTTTCAGCAGCGAGTCTGACGCCTGCGCAAAAGACCGAGTTCCATTGGCTGTAC
GGACCCTGCATCATGATCGCCTTTGCCTTTCTCGGCAACACTCTCTTCCTCACCATCCTCGTCTCGATGCTGTCC
AACACGTTCAGCAACATCTCGACCAATGCCACGGCGGAGATGCAGTTCCGGCGGGCGGTTCTGACGCTCGAGGGC
GTCAAGGCCGACGCCATCTTCGCCTACCAGCCGCCCTTTAACCTGCTGGCCGTCTTCATCTTGCTGCCGCTCAAG
TTCGTCGTCAGCCCCCGCTGGTTTCACAAGACACACGTGACGATGGTGCGGCTGGTGAACCTCCCGTTGCTGCTC
ATCATCGCCGTGGCCGAGCGGCGTCTGCTATGGCCGGCGGGCGGGCAGAAGGCGGTCAAGCCTACCAAGAGGAGA
AGGCTTTGGCGCAAATGGCAGATGACGACGCACAGGGACATCCGCCAAGTGTTTATCGTGCCGCCGCCCGACGAC
GTGCACGATGACATCGCCGTAGACGATGACTTGACGCACCACCTCATCCGGCGTCAATTCACACGACAGCCGACG
ACGACGATGATGACGACGACGACGGAGACGCAGTCACGGAAGCCCTCGCGCAGGGACTCGATGTTCCCGGGCCTC
GCCAGCAAGCTGCGCGGCTCCTTTGCCGAGGATAGCGAGGAGCAGGGGGCGGTGGCGGCGAGGGTGGAAGCGATG
GAGAAGTCGCTGAAGCGGATGGAGGGCATGCTTTCGAGGCTGGTTCCGGATGACTCGGCCTCTTCGTCTTCATCG
TCAGACGGAGGAGCCAGCAGTCTCAAGGACGGAGACGGGCTGACGATGGAGTCGAGCTCGAGGGGGCAGTTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail