Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|736
Gene name
LocationContig_1247:481..2736
Strand-
Gene length (bp)2255
Transcript length (bp)1797
Coding sequence length (bp)1797
Protein length (aa) 599

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00324 AA_permease Amino acid permease 9.2E-38 75 566
PF13520 AA_permease_2 Amino acid permease 3.3E-19 74 550

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P04817|CAN1_YEAST Arginine permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAN1 PE=1 SV=2 61 593 3.0E-34
sp|P43059|CAN1_CANAW Lysine/arginine permease OS=Candida albicans (strain WO-1) GN=CAN1 PE=3 SV=2 44 592 4.0E-31
sp|P32487|LYP1_YEAST Lysine-specific permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYP1 PE=1 SV=2 61 587 4.0E-29
sp|P53388|DIP5_YEAST Dicarboxylic amino acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIP5 PE=1 SV=1 51 534 1.0E-28
sp|P38971|ALP1_YEAST Basic amino-acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALP1 PE=1 SV=2 58 587 4.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P04817|CAN1_YEAST Arginine permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAN1 PE=1 SV=2 61 593 3.0E-34
sp|P43059|CAN1_CANAW Lysine/arginine permease OS=Candida albicans (strain WO-1) GN=CAN1 PE=3 SV=2 44 592 4.0E-31
sp|P32487|LYP1_YEAST Lysine-specific permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYP1 PE=1 SV=2 61 587 4.0E-29
sp|P53388|DIP5_YEAST Dicarboxylic amino acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIP5 PE=1 SV=1 51 534 1.0E-28
sp|P38971|ALP1_YEAST Basic amino-acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALP1 PE=1 SV=2 58 587 4.0E-28
sp|Q9P768|YI26_SCHPO Uncharacterized amino-acid permease P7G5.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAP7G5.06 PE=3 SV=1 65 453 4.0E-26
sp|Q9URZ4|CAT1_SCHPO Cationic amino acid transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cat1 PE=1 SV=3 58 492 9.0E-26
sp|Q9P5N4|YH81_SCHPO Uncharacterized amino-acid permease C359.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC359.01 PE=3 SV=2 53 492 1.0E-25
sp|Q9P5N2|AAT1_SCHPO Amino acid transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aat1 PE=3 SV=1 65 492 1.0E-25
sp|O60170|MEU22_SCHPO Probable amino-acid permease meu22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=meu22 PE=2 SV=1 57 582 1.0E-24
sp|P39636|ROCC_BACSU Amino-acid permease RocC OS=Bacillus subtilis (strain 168) GN=rocC PE=2 SV=1 60 433 2.0E-23
sp|O74543|YCV4_SCHPO Uncharacterized amino-acid permease C777.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC777.04 PE=3 SV=1 65 552 3.0E-23
sp|Q03770|SSY1_YEAST SPS-sensor component SSY1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSY1 PE=1 SV=1 65 576 1.0E-22
sp|P42087|HUTM_BACSU Putative histidine permease OS=Bacillus subtilis (strain 168) GN=hutM PE=3 SV=2 60 526 6.0E-22
sp|P25737|LYSP_ECOLI Lysine-specific permease OS=Escherichia coli (strain K12) GN=lysP PE=1 SV=5 65 572 6.0E-22
sp|P15380|PUT4_YEAST Proline-specific permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUT4 PE=2 SV=2 60 594 7.0E-22
sp|B5BP45|YP51_SCHPO Uncharacterized amino-acid permease C460.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.01c PE=3 SV=1 39 492 9.0E-22
sp|P34054|INDA1_HYPAT Amino-acid permease inda1 OS=Hypocrea atroviridis GN=inda1 PE=2 SV=1 65 531 2.0E-21
sp|P19145|GAP1_YEAST General amino-acid permease GAP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAP1 PE=1 SV=2 52 484 2.0E-21
sp|P18696|PUTX_EMENI Proline-specific permease OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prnB PE=2 SV=2 60 595 9.0E-20
sp|Q47689|MMUP_ECOLI Probable S-methylmethionine permease OS=Escherichia coli (strain K12) GN=mmuP PE=3 SV=2 58 494 2.0E-19
sp|Q9URZ3|PUT4_SCHPO Probable proline-specific permease put4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=put4 PE=3 SV=1 66 595 2.0E-19
sp|O31462|YBGF_BACSU Uncharacterized amino acid permease YbgF OS=Bacillus subtilis (strain 168) GN=ybgF PE=3 SV=1 61 527 4.0E-19
sp|Q9HDV2|YHE1_SCHPO Uncharacterized amino-acid permease PB2B2.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB2B2.01 PE=3 SV=1 60 499 1.0E-16
sp|P39137|ROCE_BACSU Amino-acid permease RocE OS=Bacillus subtilis (strain 168) GN=rocE PE=2 SV=1 57 431 1.0E-16
sp|P38090|AGP2_YEAST General amino acid permease AGP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AGP2 PE=1 SV=1 67 567 6.0E-16
sp|P0AAE0|CYCA_ECOLI D-serine/D-alanine/glycine transporter OS=Escherichia coli (strain K12) GN=cycA PE=1 SV=1 52 438 9.0E-16
sp|P0AAE1|CYCA_ECO57 D-serine/D-alanine/glycine transporter OS=Escherichia coli O157:H7 GN=cycA PE=3 SV=1 52 438 9.0E-16
sp|Q12372|MMP1_YEAST S-methylmethionine permease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MMP1 PE=1 SV=1 73 527 2.0E-15
sp|P38084|BAP2_YEAST Leu/Val/Ile amino-acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BAP2 PE=1 SV=2 60 438 3.0E-15
sp|P40901|ISP5_SCHPO Sexual differentiation process putative amino-acid permease isp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp5 PE=2 SV=2 89 589 7.0E-15
sp|P43548|AGP3_YEAST General amino acid permease AGP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AGP3 PE=1 SV=1 65 592 8.0E-15
sp|P46349|GABP_BACSU GABA permease OS=Bacillus subtilis (strain 168) GN=gabP PE=1 SV=3 65 431 8.0E-15
sp|P06775|HIP1_YEAST Histidine permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HIP1 PE=1 SV=2 50 532 1.0E-14
sp|P41815|BAP3_YEAST Valine amino-acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BAP3 PE=1 SV=2 60 431 2.0E-14
sp|O34618|YTNA_BACSU Uncharacterized amino acid permease YtnA OS=Bacillus subtilis (strain 168) GN=ytnA PE=3 SV=1 60 537 3.0E-14
sp|P24207|PHEP_ECOLI Phenylalanine-specific permease OS=Escherichia coli (strain K12) GN=pheP PE=1 SV=1 60 434 5.0E-14
sp|E1W822|AROP_SALTS Aromatic amino acid transport protein AroP OS=Salmonella typhimurium (strain SL1344) GN=aroP PE=3 SV=1 58 435 8.0E-14
sp|P0CK99|AROP_SALTY Aromatic amino acid transport protein AroP OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aroP PE=3 SV=1 58 435 8.0E-14
sp|P0A188|AROP_SALTI Aromatic amino acid transport protein AroP OS=Salmonella typhi GN=aroP PE=3 SV=1 58 435 8.0E-14
sp|P38967|TAT2_YEAST Tryptophan permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAT2 PE=1 SV=1 65 595 9.0E-14
sp|Q9C0V0|YQD2_SCHPO Probable amino-acid permease PB1C11.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCPB1C11.02 PE=3 SV=1 52 438 1.0E-13
sp|P59737|AROP_SHIFL Aromatic amino acid transport protein AroP OS=Shigella flexneri GN=aroP PE=3 SV=1 60 435 2.0E-13
sp|P15993|AROP_ECOLI Aromatic amino acid transport protein AroP OS=Escherichia coli (strain K12) GN=aroP PE=1 SV=3 60 435 2.0E-13
sp|Q8FL49|AROP_ECOL6 Aromatic amino acid transport protein AroP OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aroP PE=3 SV=1 60 435 3.0E-13
sp|Q8X968|AROP_ECO57 Aromatic amino acid transport protein AroP OS=Escherichia coli O157:H7 GN=aroP PE=3 SV=1 60 435 4.0E-13
sp|Q92367|AAP1_SCHPO Amino-acid permease 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aap1 PE=3 SV=1 69 559 3.0E-12
sp|Q08986|SAM3_YEAST S-adenosylmethionine permease SAM3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAM3 PE=1 SV=1 73 527 5.0E-12
sp|O59831|YCUB_SCHPO Uncharacterized amino-acid permease C965.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.11c PE=3 SV=1 52 585 2.0E-10
sp|Q876K6|AGP1_SACU7 General amino acid permease AGP1 OS=Saccharomyces uvarum (strain ATCC 76518 / CBS 7001 / CLIB 283 / NBRC 10550 / MCYC 623 / NCYC 2669 / NRRL Y-11845) GN=AGP1 PE=3 SV=1 52 484 3.0E-10
sp|P37460|PROY_SALTY Proline-specific permease ProY OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=proY PE=3 SV=3 60 488 3.0E-10
sp|P25527|GABP_ECOLI GABA permease OS=Escherichia coli (strain K12) GN=gabP PE=1 SV=1 60 438 4.0E-10
sp|P77610|ANSP_ECOLI L-asparagine permease OS=Escherichia coli (strain K12) GN=ansP PE=3 SV=2 61 499 1.0E-09
sp|Q46065|AROP_CORGL Aromatic amino acid transport protein AroP OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=aroP PE=3 SV=1 61 433 3.0E-09
sp|P25376|AGP1_YEAST General amino acid permease AGP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AGP1 PE=1 SV=3 32 484 4.0E-09
sp|P38085|TAT1_YEAST Valine/tyrosine/tryptophan amino-acid permease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAT1 PE=1 SV=1 52 438 7.0E-09
sp|P27837|YIFK_ECOLI Probable transport protein YifK OS=Escherichia coli (strain K12) GN=yifK PE=1 SV=4 65 282 2.0E-08
sp|A6ZTG5|AGP1_YEAS7 General amino acid permease AGP1 OS=Saccharomyces cerevisiae (strain YJM789) GN=AGP1 PE=3 SV=1 52 484 2.0E-08
sp|P40812|ANSP_SALTY L-asparagine permease OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ansP PE=3 SV=1 61 499 6.0E-08
sp|P9WQM7|ANSP2_MYCTU L-asparagine permease 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ansP2 PE=1 SV=1 61 524 8.0E-08
sp|P9WQM6|ANSP2_MYCTO L-asparagine permease 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ansP2 PE=3 SV=1 61 524 8.0E-08
sp|P0A4W1|ANSP2_MYCBO L-asparagine permease 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ansP2 PE=3 SV=1 61 524 8.0E-08
sp|P0A190|YIFK_SALTI Probable transport protein YifK OS=Salmonella typhi GN=yifK PE=3 SV=1 65 211 3.0E-07
sp|P0A189|YIFK_SALTY Probable transport protein YifK OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=yifK PE=3 SV=1 65 211 3.0E-07
sp|Q9X7P0|ANSP_STRCO L-asparagine permease OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=ansP PE=3 SV=1 42 491 4.0E-07
sp|P96704|YDGF_BACSU Uncharacterized transporter YdgF OS=Bacillus subtilis (strain 168) GN=ydgF PE=3 SV=1 61 438 4.0E-07
sp|P0AAE2|PROY_ECOLI Proline-specific permease ProY OS=Escherichia coli (strain K12) GN=proY PE=1 SV=1 66 482 6.0E-07
sp|P0AAE3|PROY_ECOL6 Proline-specific permease ProY OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=proY PE=3 SV=1 66 482 6.0E-07
sp|P0AAE4|PROY_ECO57 Proline-specific permease ProY OS=Escherichia coli O157:H7 GN=proY PE=3 SV=1 66 482 6.0E-07
sp|P9WQM9|ANSP1_MYCTU L-asparagine permease 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ansP1 PE=1 SV=1 60 482 1.0E-06
sp|P9WQM8|ANSP1_MYCTO L-asparagine permease 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ansP1 PE=3 SV=1 60 482 1.0E-06
sp|P48813|GNP1_YEAST High-affinity glutamine permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GNP1 PE=1 SV=2 60 592 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

Domain # Start End Length
1 70 92 22
2 112 134 22
3 146 168 22
4 183 202 19
5 209 231 22
6 251 273 22
7 304 326 22
8 371 390 19
9 425 442 17
10 457 479 22
11 516 538 22
12 542 564 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|736
MPDDSQAEFQTWLPDWLQPALFAGSAPAGRPTPPAPPPPPPAAHPAPFVRRDKVVLVTPSQDRMVNRKLRGINLS
MIAVNATLGSGLYWTGGQVLKIGGPLAAPLSFLLPGLLAWGVMQCVSEMLCIWPIPGALSVYVAEFVDVELGIAV
GVAYWFTYSVSFAALIATSAAEIHLWLPTNKVFDGVVVYLLIPVTLVLINSFEVEIYGWLEVVGSSIKITCLVVV
MILVGVLMDVWRAPVVFDRDVTNNWATAFAICLSMATFAYVGVEVVAASALEARWPSRKESSKRNSDELLISKTV
KFSAVYIPMFATAAYTLAALLASFSIDRGNCDLPRLSWINSSCGSGPQGGTASIFVVIARNSTRPALKDVFNVIL
VFSVLTCANTNLYVASRTLFGLTTRLDGSPTQQPLLRFLAWFGRTNRRKVPLRALIFSAVAFLWVPFLQLDEGND
ISEFIEILAKMGTNGVVIVWACECWAFIRFYRCIWRHRAALKLHKVGQVRRWDEDDHYPYRSHGQPFVAYAALAG
CIFILVVSNGAPLWNGFYLTPFLAFFLLPLVFLALWVLLKVMSGARWSLVDLSNEAKVVSKLRDLHDIRQGAS*
Coding >Ophun1|736
ATGCCCGACGATTCGCAGGCCGAGTTCCAGACCTGGCTGCCAGACTGGCTGCAGCCGGCCCTGTTCGCCGGCTCC
GCTCCGGCCGGCAGACCCACACCGCCGGCTCCCCCCCCGCCTCCCCCGGCGGCCCACCCGGCGCCCTTCGTCCGG
CGCGACAAAGTGGTGCTAGTGACGCCGAGCCAAGACCGGATGGTGAACCGCAAGCTCCGCGGCATCAACCTATCG
ATGATCGCCGTCAACGCCACTCTAGGATCAGGCTTGTACTGGACGGGCGGGCAGGTGCTCAAGATAGGAGGGCCG
CTGGCAGCGCCGCTCTCGTTCCTGCTTCCGGGGCTGTTGGCGTGGGGGGTGATGCAGTGCGTTAGCGAGATGTTG
TGCATATGGCCGATTCCCGGTGCCTTGTCTGTTTACGTGGCTGAGTTTGTCGATGTTGAGTTGGGGATTGCGGTG
GGGGTTGCCTACTGGTTTACGTATTCTGTTTCGTTTGCTGCGCTTATTGCTACTTCGGCGGCTGAGATTCACCTG
TGGCTTCCTACGAACAAGGTGTTTGACGGCGTTGTCGTATATCTTCTCATACCCGTCACCTTGGTCCTCATCAAT
AGCTTCGAGGTGGAAATCTACGGATGGCTCGAGGTCGTCGGCAGCAGCATCAAAATCACCTGCCTCGTCGTCGTC
ATGATTCTCGTCGGCGTCTTGATGGACGTGTGGCGTGCCCCCGTCGTCTTCGACCGCGACGTCACCAACAACTGG
GCCACAGCCTTTGCCATCTGCCTCTCCATGGCAACCTTCGCCTACGTCGGCGTCGAAGTCGTCGCCGCCTCCGCC
CTCGAAGCCCGCTGGCCATCGAGAAAGGAATCGTCCAAGCGCAACAGCGACGAGCTCCTCATCAGCAAGACGGTC
AAGTTCTCAGCCGTCTACATCCCCATGTTCGCCACGGCCGCCTACACGCTGGCCGCGCTGCTGGCTTCCTTTAGC
ATCGACCGCGGCAACTGCGATCTCCCGCGTCTTAGCTGGATCAATAGCTCGTGCGGCTCCGGGCCTCAGGGAGGC
ACCGCTTCCATCTTTGTCGTCATCGCTCGTAACTCGACCAGGCCGGCGCTCAAGGACGTCTTCAACGTCATCCTC
GTCTTCAGCGTCTTGACCTGCGCGAATACTAACCTCTACGTTGCCTCTCGCACCCTCTTCGGTCTCACTACCAGG
CTCGACGGCTCCCCGACCCAGCAACCCCTGTTGCGCTTCCTGGCTTGGTTCGGCAGGACGAATCGTCGTAAAGTG
CCGCTGCGGGCTCTGATATTCTCTGCCGTTGCCTTTTTATGGGTTCCGTTTCTGCAGCTGGACGAGGGCAACGAC
ATTTCCGAGTTCATCGAGATCCTGGCCAAGATGGGAACCAACGGCGTCGTCATCGTCTGGGCCTGCGAGTGCTGG
GCTTTTATCCGCTTCTACCGCTGCATCTGGAGGCACCGCGCCGCCCTCAAGTTACACAAGGTCGGCCAGGTCCGC
CGCTGGGACGAAGACGATCACTATCCCTACCGCAGCCACGGCCAGCCGTTTGTCGCCTACGCAGCGCTGGCCGGC
TGCATCTTCATCCTGGTCGTGTCCAACGGGGCACCGCTGTGGAACGGCTTCTACCTGACTCCGTTTCTGGCATTT
TTCCTGCTGCCGCTCGTCTTCTTGGCGCTGTGGGTGTTGCTCAAGGTCATGAGCGGTGCTCGGTGGTCGCTGGTG
GATCTGAGCAATGAGGCCAAGGTTGTGAGCAAGCTGCGCGACTTGCACGATATTCGGCAGGGGGCGAGTTGA
Transcript >Ophun1|736
ATGCCCGACGATTCGCAGGCCGAGTTCCAGACCTGGCTGCCAGACTGGCTGCAGCCGGCCCTGTTCGCCGGCTCC
GCTCCGGCCGGCAGACCCACACCGCCGGCTCCCCCCCCGCCTCCCCCGGCGGCCCACCCGGCGCCCTTCGTCCGG
CGCGACAAAGTGGTGCTAGTGACGCCGAGCCAAGACCGGATGGTGAACCGCAAGCTCCGCGGCATCAACCTATCG
ATGATCGCCGTCAACGCCACTCTAGGATCAGGCTTGTACTGGACGGGCGGGCAGGTGCTCAAGATAGGAGGGCCG
CTGGCAGCGCCGCTCTCGTTCCTGCTTCCGGGGCTGTTGGCGTGGGGGGTGATGCAGTGCGTTAGCGAGATGTTG
TGCATATGGCCGATTCCCGGTGCCTTGTCTGTTTACGTGGCTGAGTTTGTCGATGTTGAGTTGGGGATTGCGGTG
GGGGTTGCCTACTGGTTTACGTATTCTGTTTCGTTTGCTGCGCTTATTGCTACTTCGGCGGCTGAGATTCACCTG
TGGCTTCCTACGAACAAGGTGTTTGACGGCGTTGTCGTATATCTTCTCATACCCGTCACCTTGGTCCTCATCAAT
AGCTTCGAGGTGGAAATCTACGGATGGCTCGAGGTCGTCGGCAGCAGCATCAAAATCACCTGCCTCGTCGTCGTC
ATGATTCTCGTCGGCGTCTTGATGGACGTGTGGCGTGCCCCCGTCGTCTTCGACCGCGACGTCACCAACAACTGG
GCCACAGCCTTTGCCATCTGCCTCTCCATGGCAACCTTCGCCTACGTCGGCGTCGAAGTCGTCGCCGCCTCCGCC
CTCGAAGCCCGCTGGCCATCGAGAAAGGAATCGTCCAAGCGCAACAGCGACGAGCTCCTCATCAGCAAGACGGTC
AAGTTCTCAGCCGTCTACATCCCCATGTTCGCCACGGCCGCCTACACGCTGGCCGCGCTGCTGGCTTCCTTTAGC
ATCGACCGCGGCAACTGCGATCTCCCGCGTCTTAGCTGGATCAATAGCTCGTGCGGCTCCGGGCCTCAGGGAGGC
ACCGCTTCCATCTTTGTCGTCATCGCTCGTAACTCGACCAGGCCGGCGCTCAAGGACGTCTTCAACGTCATCCTC
GTCTTCAGCGTCTTGACCTGCGCGAATACTAACCTCTACGTTGCCTCTCGCACCCTCTTCGGTCTCACTACCAGG
CTCGACGGCTCCCCGACCCAGCAACCCCTGTTGCGCTTCCTGGCTTGGTTCGGCAGGACGAATCGTCGTAAAGTG
CCGCTGCGGGCTCTGATATTCTCTGCCGTTGCCTTTTTATGGGTTCCGTTTCTGCAGCTGGACGAGGGCAACGAC
ATTTCCGAGTTCATCGAGATCCTGGCCAAGATGGGAACCAACGGCGTCGTCATCGTCTGGGCCTGCGAGTGCTGG
GCTTTTATCCGCTTCTACCGCTGCATCTGGAGGCACCGCGCCGCCCTCAAGTTACACAAGGTCGGCCAGGTCCGC
CGCTGGGACGAAGACGATCACTATCCCTACCGCAGCCACGGCCAGCCGTTTGTCGCCTACGCAGCGCTGGCCGGC
TGCATCTTCATCCTGGTCGTGTCCAACGGGGCACCGCTGTGGAACGGCTTCTACCTGACTCCGTTTCTGGCATTT
TTCCTGCTGCCGCTCGTCTTCTTGGCGCTGTGGGTGTTGCTCAAGGTCATGAGCGGTGCTCGGTGGTCGCTGGTG
GATCTGAGCAATGAGGCCAAGGTTGTGAGCAAGCTGCGCGACTTGCACGATATTCGGCAGGGGGCGAGTTGA
Gene >Ophun1|736
ATGCCCGACGATTCGCAGGCCGAGTTCCAGACCTGGCTGCCAGACTGGCTGCAGCCGGCCCTGTTCGCCGGCTCC
GCTCCGGCCGGCAGACCCACACCGCCGGCTCCCCCCCCGCCTCCCCCGGCGGCCCACCCGGCGCCCTTCGTCCGG
CGCGACAAAGTGGTGCTAGTGACGCCGAGCCAAGACCGGATGGTGAACCGCAAGCTCCGCGGCATCAACCTATCG
GTTCGCAACCCCCTCGAATGAGAAAGTAGCCCCAGCTGACGAGAACCCCCCCTTAGATGATCGCCGTCAACGCCA
CTCTAGGATCAGGCTTGTACTGGACGGGCGGGCAGGTGCTCAAGATAGGAGGGCCGCTGGCAGCGCCGCTCTCGT
TCCTGCTTCCGGGGCTGTTGGCGTGGGGGGTGATGCAGTGCGTTAGCGAGATGTTGTGCATATGGCCGATTCCCG
GTGCCTTGTCTGTTTACGTGGCTGAGTTTGTCGATGTTGAGTTGGGGATTGCGGTGGGGGTTGCCTACTGGTGAG
TCTTATGGCCGTCATGTACGGAAGTATACGTGCTTCGAGTGCTGATGGGACGAGGTTTACGTATTCTGTTTCGTT
TGCTGCGCTTATTGCTACTTCGGCGGCTGAGATTCACCTGTGGCTTCCTACGAACAAGGTGTTTGACGGCGTTGT
CGTATATCTTCTCATACCCGTCACCTTGGTCCTCATCAATAGCTTCGAGGTGGAAATCTACGGATGGCTCGAGGT
CGTCGGCAGCAGCATCAAAATCACCTGCCTCGTCGTCGTCATGATTCTCGTCGGCGTCTTGATGGACGGTGGGTG
TTCCTGGTCTCGGTATCAACAGACAGCTAACCAGCAGGTAGAGTCGCCCGTTCACCCCAAGGGAATCGAATGTGA
ATCCTTCCGAGTCTGCTTCGCCATCCCTTGCTAACAGCAGCAGTGTGGCGTGCCCCCGTCGTCTTCGACCGCGAC
GTCACCAACAACTGGGCCACAGCCTTTGCGTACGCCCCTACTCCCCTCATCAACAAACCCCCAAACTAACTCACC
AAAGCATCTGCCTCTCCATGGCAACCTTCGCCTACGTCGGCGTCGAAGTCGTCGCCGCCTCCGCCCTCGAAGCCC
GCTGGCCATCGAGAAAGGAATCGTCCAAGCGCAACAGCGACGAGCTCCTCATCAGCAAGACGGTCAAGTTCTCAG
CCGTCTACATCCCCATGTTCGCCACGGCCGCCTACACGCTGGCCGCGCTGCTGGCTTCCTTTAGCATCGACCGCG
GCAACTGCGATCTCCCGCGTCTTAGCTGGATCAATAGCTCGTGCGGCTCCGGGCCTCAGGGAGGCACCGCTTCCA
TCTTTGTCGTCATCGCTCGTAACTCGACCAGGCCGGCGCTCAAGGACGTCTTCAACGTCATCCTCGTCTTCAGCG
TCTTGACCTGCGCGAATACTAACCTCTACGTTGCCTCTCGCACCCTCTTCGGTCTCACTACCAGGCTCGACGGCT
CCCCGACCCAGCAACCCCTGTTGCGCTTCCTGGCTTGGTTCGGCAGGACGAATCGTCGTAAAGTGCCGCTGCGGG
CTCTGATATTCTCTGCCGTTGCCTTTTTATGGGTTCCGTTTCTGCAGCTGGACGAGGGCAACGACATTTCCGAGG
TGAGTGTGCGTTGAGCTCAGGAGATTCTTCTGCTAACGCTGTCGATCAGTTCATCGAGATCCTGGCCAAGATGGG
AACCAACGGCGTCGTCATCGTCTGGGCCTGCGAGTGCTGGGCTTTTATCCGCTTCTACCGCTGGTTAGTGTAATC
CATCTCCCATATCAATAGACGAACCAGCAGCTAAAGCATCAACCCGCCCAGCATCTGGAGGCACCGCGCCGCCCT
CAAGTTACACAAGGTCGGCCAGGTCCGCCGCTGGGACGAAGACGATCACTATCCCTACCGCAGCCACGGCCAGCC
GTTTGTCGCCTACGCAGCGCTGGCCGGCTGCATCTTCATCCTGGTCGTGTCCAACGGGGCACCGCTGTGGAACGG
CTTCTACCTGACTCCGTTTCTGGCATTTTTCCTGCTGGTAAGCCGTCTGCGTCTTATTCGCGTGTGTACAGACTT
AGGCTGATGCTGGGCAGCCGCTCGTCTTCTTGGCGCTGTGGGTGTTGCTCAAGGTCATGAGCGGTGCTCGGTGGT
CGCTGGTGGATCTGAGCAATGAGGCCAAGGTTGTGAGCAAGCTGCGCGACTTGCACGATATTCGGCAGGGGGCGA
GTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail