Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7348
Gene name
LocationContig_908:3621..4797
Strand+
Gene length (bp)1176
Transcript length (bp)1176
Coding sequence length (bp)1176
Protein length (aa) 392

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q84W55|IP5PF_ARATH Type II inositol polyphosphate 5-phosphatase 15 OS=Arabidopsis thaliana GN=IP5P15 PE=1 SV=2 6 317 3.0E-15
sp|O15357|SHIP2_HUMAN Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 OS=Homo sapiens GN=INPPL1 PE=1 SV=2 22 309 7.0E-14
sp|Q6P549|SHIP2_MOUSE Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 OS=Mus musculus GN=Inppl1 PE=1 SV=1 22 309 2.0E-13
sp|Q9WVR3|SHIP2_RAT Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 OS=Rattus norvegicus GN=Inppl1 PE=1 SV=1 22 309 2.0E-13
sp|Q9SKB7|IP5PE_ARATH Type II inositol polyphosphate 5-phosphatase 14 OS=Arabidopsis thaliana GN=IP5P14 PE=1 SV=1 42 317 3.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q84W55|IP5PF_ARATH Type II inositol polyphosphate 5-phosphatase 15 OS=Arabidopsis thaliana GN=IP5P15 PE=1 SV=2 6 317 3.0E-15
sp|O15357|SHIP2_HUMAN Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 OS=Homo sapiens GN=INPPL1 PE=1 SV=2 22 309 7.0E-14
sp|Q6P549|SHIP2_MOUSE Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 OS=Mus musculus GN=Inppl1 PE=1 SV=1 22 309 2.0E-13
sp|Q9WVR3|SHIP2_RAT Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 OS=Rattus norvegicus GN=Inppl1 PE=1 SV=1 22 309 2.0E-13
sp|Q9SKB7|IP5PE_ARATH Type II inositol polyphosphate 5-phosphatase 14 OS=Arabidopsis thaliana GN=IP5P14 PE=1 SV=1 42 317 3.0E-12
sp|Q2I6J1|SHP2A_DANRE Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2A OS=Danio rerio GN=inppl1a PE=2 SV=2 24 309 2.0E-11
sp|Q6P4S2|SHIP1_XENLA Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1 OS=Xenopus laevis GN=inpp5d PE=2 SV=1 30 309 3.0E-11
sp|O80560|IP5PC_ARATH Type I inositol polyphosphate 5-phosphatase 12 OS=Arabidopsis thaliana GN=IP5P12 PE=1 SV=2 43 308 9.0E-11
sp|O14306|YE8A_SCHPO Probable inositol polyphosphate 5-phosphatase C9G1.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC9G1.10c PE=1 SV=2 50 308 2.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 366 385 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7348
MEPRDDHQTPFTLVRAGNVGYTAMMLFARHPTRLSSVLEAEVGFGAADMGNKGAVGMRTLYSDPDGGEAELTFVA
THLAAMEWNLPRRNANWAAIMRGLTFANPEEVLSGEDESEDARLLPRGDDGDEDEGDGQQHARLRRRLHDLSVYK
PSSHLFVAGDLNYRIATTPPPAGAVLPSLDPTSPSHFSVFLPLDQLTRERRAGRTLHGLVEAPVKFPPTYKYMPM
EEGEEEDGGGFFDESGYYEHGDEDDDEDDDEDTDVVRWRFASHRWPAWTDRILYLDAPPSDPQIEVRAYDALPVV
RTSDHRAVFLRASVPLAPRTGPLSASDPRRRLPVEIDPEAWARRMAARRKERVLGWTLLLWGSREGGWVLLLALV
VGLSGWYWGFYRVSET*
Coding >Ophun1|7348
ATGGAGCCGAGAGATGACCACCAAACCCCCTTTACGCTCGTCAGAGCCGGCAATGTCGGGTACACGGCCATGATG
CTCTTCGCGCGGCACCCGACGCGGCTGAGTTCCGTGCTCGAGGCCGAGGTGGGATTCGGCGCGGCCGACATGGGC
AACAAGGGAGCCGTCGGCATGCGTACCCTCTACTCGGATCCGGACGGCGGAGAGGCGGAGCTGACGTTTGTGGCG
ACGCACCTGGCGGCTATGGAGTGGAACCTGCCGAGGCGGAACGCGAATTGGGCGGCCATTATGCGTGGGCTGACA
TTTGCGAATCCGGAAGAGGTGCTTTCCGGGGAGGATGAGAGCGAGGATGCCCGTCTGCTTCCGCGTGGCGATGAC
GGGGACGAAGACGAGGGAGATGGTCAGCAGCACGCACGTCTGCGGCGACGGCTTCACGACTTGTCCGTATACAAG
CCGTCGTCACACCTGTTTGTCGCCGGCGACCTCAACTACCGGATCGCGACGACGCCTCCGCCGGCGGGTGCGGTG
CTGCCGAGCCTCGACCCGACGTCGCCGAGCCACTTCAGTGTCTTTCTGCCGCTGGACCAGTTGACACGCGAGCGG
CGGGCTGGCAGGACGCTGCATGGGTTGGTGGAGGCGCCCGTCAAGTTCCCGCCGACGTACAAGTATATGCCGATG
GAGGAGGGGGAGGAGGAGGATGGAGGGGGGTTCTTCGACGAGAGTGGGTATTACGAGCATGGCGATGAGGATGAC
GACGAGGATGACGACGAGGATACGGACGTGGTTCGCTGGCGCTTCGCCTCTCATCGCTGGCCGGCTTGGACGGAT
CGCATCCTCTACCTCGACGCACCCCCTTCCGACCCCCAGATCGAGGTACGAGCCTACGACGCCCTGCCGGTAGTG
CGAACGAGCGACCACCGAGCCGTCTTCCTCCGGGCTTCGGTGCCGCTGGCGCCCCGGACGGGCCCGCTCTCGGCG
TCGGACCCCCGGCGACGGCTGCCGGTCGAGATCGACCCGGAGGCCTGGGCGAGACGGATGGCGGCCCGGCGCAAG
GAGCGCGTTCTCGGCTGGACTTTGCTGCTTTGGGGGTCGAGGGAGGGGGGATGGGTGTTGCTTTTGGCGCTGGTG
GTTGGGCTCAGTGGATGGTATTGGGGGTTTTATCGGGTGAGTGAGACTTAG
Transcript >Ophun1|7348
ATGGAGCCGAGAGATGACCACCAAACCCCCTTTACGCTCGTCAGAGCCGGCAATGTCGGGTACACGGCCATGATG
CTCTTCGCGCGGCACCCGACGCGGCTGAGTTCCGTGCTCGAGGCCGAGGTGGGATTCGGCGCGGCCGACATGGGC
AACAAGGGAGCCGTCGGCATGCGTACCCTCTACTCGGATCCGGACGGCGGAGAGGCGGAGCTGACGTTTGTGGCG
ACGCACCTGGCGGCTATGGAGTGGAACCTGCCGAGGCGGAACGCGAATTGGGCGGCCATTATGCGTGGGCTGACA
TTTGCGAATCCGGAAGAGGTGCTTTCCGGGGAGGATGAGAGCGAGGATGCCCGTCTGCTTCCGCGTGGCGATGAC
GGGGACGAAGACGAGGGAGATGGTCAGCAGCACGCACGTCTGCGGCGACGGCTTCACGACTTGTCCGTATACAAG
CCGTCGTCACACCTGTTTGTCGCCGGCGACCTCAACTACCGGATCGCGACGACGCCTCCGCCGGCGGGTGCGGTG
CTGCCGAGCCTCGACCCGACGTCGCCGAGCCACTTCAGTGTCTTTCTGCCGCTGGACCAGTTGACACGCGAGCGG
CGGGCTGGCAGGACGCTGCATGGGTTGGTGGAGGCGCCCGTCAAGTTCCCGCCGACGTACAAGTATATGCCGATG
GAGGAGGGGGAGGAGGAGGATGGAGGGGGGTTCTTCGACGAGAGTGGGTATTACGAGCATGGCGATGAGGATGAC
GACGAGGATGACGACGAGGATACGGACGTGGTTCGCTGGCGCTTCGCCTCTCATCGCTGGCCGGCTTGGACGGAT
CGCATCCTCTACCTCGACGCACCCCCTTCCGACCCCCAGATCGAGGTACGAGCCTACGACGCCCTGCCGGTAGTG
CGAACGAGCGACCACCGAGCCGTCTTCCTCCGGGCTTCGGTGCCGCTGGCGCCCCGGACGGGCCCGCTCTCGGCG
TCGGACCCCCGGCGACGGCTGCCGGTCGAGATCGACCCGGAGGCCTGGGCGAGACGGATGGCGGCCCGGCGCAAG
GAGCGCGTTCTCGGCTGGACTTTGCTGCTTTGGGGGTCGAGGGAGGGGGGATGGGTGTTGCTTTTGGCGCTGGTG
GTTGGGCTCAGTGGATGGTATTGGGGGTTTTATCGGGTGAGTGAGACTTAG
Gene >Ophun1|7348
ATGGAGCCGAGAGATGACCACCAAACCCCCTTTACGCTCGTCAGAGCCGGCAATGTCGGGTACACGGCCATGATG
CTCTTCGCGCGGCACCCGACGCGGCTGAGTTCCGTGCTCGAGGCCGAGGTGGGATTCGGCGCGGCCGACATGGGC
AACAAGGGAGCCGTCGGCATGCGTACCCTCTACTCGGATCCGGACGGCGGAGAGGCGGAGCTGACGTTTGTGGCG
ACGCACCTGGCGGCTATGGAGTGGAACCTGCCGAGGCGGAACGCGAATTGGGCGGCCATTATGCGTGGGCTGACA
TTTGCGAATCCGGAAGAGGTGCTTTCCGGGGAGGATGAGAGCGAGGATGCCCGTCTGCTTCCGCGTGGCGATGAC
GGGGACGAAGACGAGGGAGATGGTCAGCAGCACGCACGTCTGCGGCGACGGCTTCACGACTTGTCCGTATACAAG
CCGTCGTCACACCTGTTTGTCGCCGGCGACCTCAACTACCGGATCGCGACGACGCCTCCGCCGGCGGGTGCGGTG
CTGCCGAGCCTCGACCCGACGTCGCCGAGCCACTTCAGTGTCTTTCTGCCGCTGGACCAGTTGACACGCGAGCGG
CGGGCTGGCAGGACGCTGCATGGGTTGGTGGAGGCGCCCGTCAAGTTCCCGCCGACGTACAAGTATATGCCGATG
GAGGAGGGGGAGGAGGAGGATGGAGGGGGGTTCTTCGACGAGAGTGGGTATTACGAGCATGGCGATGAGGATGAC
GACGAGGATGACGACGAGGATACGGACGTGGTTCGCTGGCGCTTCGCCTCTCATCGCTGGCCGGCTTGGACGGAT
CGCATCCTCTACCTCGACGCACCCCCTTCCGACCCCCAGATCGAGGTACGAGCCTACGACGCCCTGCCGGTAGTG
CGAACGAGCGACCACCGAGCCGTCTTCCTCCGGGCTTCGGTGCCGCTGGCGCCCCGGACGGGCCCGCTCTCGGCG
TCGGACCCCCGGCGACGGCTGCCGGTCGAGATCGACCCGGAGGCCTGGGCGAGACGGATGGCGGCCCGGCGCAAG
GAGCGCGTTCTCGGCTGGACTTTGCTGCTTTGGGGGTCGAGGGAGGGGGGATGGGTGTTGCTTTTGGCGCTGGTG
GTTGGGCTCAGTGGATGGTATTGGGGGTTTTATCGGGTGAGTGAGACTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail