Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7341
Gene name
LocationContig_903:2007..5385
Strand-
Gene length (bp)3378
Transcript length (bp)2790
Coding sequence length (bp)2790
Protein length (aa) 930

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18806 Importin_rep_3 Importin 13 repeat 2.0E-06 803 868

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09796|KA111_SCHPO Importin beta-like protein kap111 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kap111 PE=3 SV=1 13 632 2.0E-36
sp|P32767|KA122_YEAST Importin beta-like protein KAP122 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KAP122 PE=1 SV=1 14 918 6.0E-17
sp|Q9JM04|IPO13_RAT Importin-13 OS=Rattus norvegicus GN=Ipo13 PE=2 SV=1 30 645 4.0E-12
sp|A7YWD2|IPO13_BOVIN Importin-13 OS=Bos taurus GN=IPO13 PE=2 SV=1 30 645 5.0E-12
sp|Q8K0C1|IPO13_MOUSE Importin-13 OS=Mus musculus GN=Ipo13 PE=1 SV=1 30 645 4.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09796|KA111_SCHPO Importin beta-like protein kap111 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kap111 PE=3 SV=1 13 632 2.0E-36
sp|P32767|KA122_YEAST Importin beta-like protein KAP122 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KAP122 PE=1 SV=1 14 918 6.0E-17
sp|Q9JM04|IPO13_RAT Importin-13 OS=Rattus norvegicus GN=Ipo13 PE=2 SV=1 30 645 4.0E-12
sp|A7YWD2|IPO13_BOVIN Importin-13 OS=Bos taurus GN=IPO13 PE=2 SV=1 30 645 5.0E-12
sp|Q8K0C1|IPO13_MOUSE Importin-13 OS=Mus musculus GN=Ipo13 PE=1 SV=1 30 645 4.0E-11
sp|O94829|IPO13_HUMAN Importin-13 OS=Homo sapiens GN=IPO13 PE=1 SV=3 30 645 4.0E-11
sp|Q5R974|IPO13_PONAB Importin-13 OS=Pongo abelii GN=IPO13 PE=2 SV=1 30 645 2.0E-10
sp|Q5ZIC8|IPO13_CHICK Importin-13 OS=Gallus gallus GN=IPO13 PE=2 SV=1 223 616 3.0E-07
sp|Q09796|KA111_SCHPO Importin beta-like protein kap111 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kap111 PE=3 SV=1 763 922 5.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7341
MTAPCACWLTSTELILSLYQPNSPQIIADAQACLSRFQGSPQAWIMIQDLLQRPDENVKFFGALTVIIKLNKESS
ALSNEDAIELLVRLVGWYIRSLVHSDSHMVLRKLSSAIATYFIHFHHLWPLYLRHIVLCLACGQSLNPLETRELN
ELSSALSSLCPRRLQAAVWVVTCVMEDASRIDLSAGNKSLYEAILRNVPEAVALVTKCLSSDNTAAALSVESLRC
VQAWIIFAQKTSPGLTHDTLSLRPLIEAVILSLSDKDTFEASAELLVDILTNCPLLLTSEHYDNLSKQLGALWAV
ERYHRLLRGDFDPESMQFGQLLIAFGEARTEALIQTNDEIHNHILSALCGLLTVHGYLIMEDKIFVSAVEFWSTY
TEAVADIIHFGSDDDVSDARVSGATSHVSKAVFSVWQKIIYPPPEVFQQWDSGDRAGFNDARKDVLDLLQSAHTV
LGPGLIASFADLVLSALESSAWLPLEAATFCLGGLAECGKGDGRFDEALTSVFASPLTSILQSRDPDIDLRARQS
CFYLIEQYAEYFERNTTLLGPVLRLLFEVLSDQSTAASASRSILLLCSSCRHHLHPQIDEFLLVYSVKVIENRLD
CVSNEKVLGAIASIAQAIPNAERRHGVCMMILEFVQNDVALAQAVTTSAEAANFRCQVLRCPRIVADEDPATHTG
LRALKCLVSVGKGYQSPCDVTIDIEGNNQQDEVIGDALPLIHDKLMSIIVELQHTFPRSSEVMELVCSVFRYPDH
DPELSQNGIELASRILSRAPLVVLGLQPPEAAEFLLMFTIKVLDGREPLPKGAAAEFWTAFVSLKSDDGNVEPAM
RRAMQTLGPILAQSLARNIGGNASRSELDKLSEPLKKLVVRHPMAKEWLQLGLNHESFPSTQVTSEQKALLVRKI
ISLRGSRATNQVIREFWLTSRGSNFAYAS*
Coding >Ophun1|7341
ATGACCGCTCCCTGTGCTTGCTGGCTAACCTCCACCGAGCTGATACTGAGCCTCTATCAACCCAACTCACCGCAA
ATAATCGCCGATGCACAAGCGTGTCTATCGCGATTCCAAGGCTCACCGCAGGCATGGATCATGATTCAGGATCTT
CTTCAAAGACCCGACGAAAATGTGAAGTTCTTCGGCGCCTTGACGGTCATCATCAAGCTTAACAAGGAGAGCTCC
GCTCTAAGTAATGAAGATGCAATCGAGCTTCTCGTTCGCTTGGTGGGGTGGTACATCCGCTCTTTGGTCCATTCG
GACAGTCACATGGTGCTGAGGAAGCTATCTTCCGCAATCGCGACGTATTTCATTCATTTCCATCACCTGTGGCCT
CTATACCTTCGCCACATCGTTCTCTGCTTGGCTTGTGGTCAATCTTTGAACCCTCTGGAGACTCGTGAACTCAAC
GAGCTCTCGTCTGCGCTGAGCAGTCTGTGTCCGCGGCGATTGCAAGCCGCCGTGTGGGTGGTCACTTGTGTCATG
GAAGACGCTTCCAGGATCGACTTGAGCGCGGGTAATAAAAGCCTCTACGAGGCCATCTTGCGCAATGTTCCAGAA
GCAGTGGCCCTTGTGACCAAGTGCCTATCATCTGACAACACTGCGGCAGCTCTTTCTGTCGAATCCTTACGATGC
GTTCAAGCATGGATCATTTTTGCCCAAAAAACGTCCCCCGGGCTTACCCATGACACTCTGTCTTTGAGGCCCCTG
ATTGAAGCAGTCATACTGTCGCTTTCGGACAAGGATACGTTTGAAGCTTCGGCGGAGCTGCTCGTAGACATCCTA
ACCAACTGCCCGTTGCTTCTAACCAGTGAACACTACGACAACTTGAGCAAGCAATTGGGGGCCCTTTGGGCTGTC
GAACGTTATCATAGACTGCTTCGGGGCGACTTCGACCCTGAATCTATGCAGTTTGGGCAGCTTCTCATAGCATTC
GGTGAGGCGAGGACGGAGGCTCTGATACAGACCAACGACGAAATCCACAACCATATTCTGTCCGCGCTTTGTGGT
CTTCTAACTGTTCACGGATATCTTATAATGGAGGACAAGATCTTCGTTTCTGCAGTAGAATTTTGGTCAACATAT
ACGGAGGCTGTGGCAGATATCATTCATTTCGGGTCAGATGATGATGTATCGGATGCACGGGTCTCTGGCGCCACA
TCTCACGTCTCCAAGGCGGTTTTCAGCGTTTGGCAAAAGATCATATATCCCCCGCCCGAGGTATTTCAGCAGTGG
GATTCCGGCGATCGCGCAGGATTCAACGACGCACGAAAAGACGTATTGGACCTCTTACAGTCTGCACATACTGTG
CTCGGACCTGGGCTCATCGCGAGTTTTGCGGATCTCGTTCTCTCCGCATTGGAAAGCTCGGCATGGCTGCCATTG
GAGGCTGCAACATTCTGTCTTGGAGGCTTGGCGGAGTGTGGCAAAGGAGACGGGCGCTTCGATGAGGCTTTGACT
TCCGTCTTCGCCTCGCCTCTTACCTCAATCCTTCAATCGAGGGACCCCGACATAGACTTGCGTGCTCGGCAGTCA
TGCTTCTATCTAATAGAACAGTACGCAGAATATTTCGAACGCAACACTACACTCCTCGGCCCTGTTCTGCGCCTA
TTATTCGAGGTGCTGAGCGACCAGTCTACCGCTGCATCTGCCTCAAGATCGATACTGTTATTGTGCTCCTCCTGC
CGGCATCATCTCCATCCTCAAATCGACGAATTTCTCCTTGTTTACTCGGTCAAGGTCATTGAGAATCGGCTAGAC
TGCGTTTCGAACGAAAAGGTGCTCGGAGCAATCGCCTCCATTGCGCAGGCTATCCCGAATGCCGAGCGACGTCAT
GGCGTGTGTATGATGATTCTGGAATTTGTACAGAACGACGTAGCTCTGGCTCAGGCAGTGACCACATCGGCAGAA
GCGGCAAACTTCCGCTGCCAGGTGTTGCGATGTCCAAGGATCGTGGCTGACGAAGATCCGGCAACTCACACCGGC
CTGCGAGCACTGAAGTGTCTCGTGAGTGTGGGGAAGGGTTACCAGTCCCCGTGTGATGTCACGATCGACATCGAG
GGCAACAATCAGCAAGATGAAGTCATTGGCGATGCTCTGCCCCTTATACATGACAAATTGATGAGCATCATTGTC
GAACTTCAGCATACGTTCCCCAGGAGTTCGGAAGTTATGGAGCTTGTTTGCAGCGTTTTCCGCTATCCAGACCAC
GATCCGGAGCTATCCCAGAATGGAATCGAGTTGGCCTCACGGATCTTGTCCAGAGCTCCACTCGTAGTTCTTGGC
CTGCAGCCTCCAGAGGCGGCAGAATTCCTCTTGATGTTCACCATCAAAGTCCTTGATGGAAGGGAGCCCCTACCG
AAAGGTGCCGCTGCCGAATTTTGGACTGCATTTGTGAGCCTCAAGAGCGACGACGGAAATGTCGAGCCAGCGATG
AGGCGTGCCATGCAAACTCTAGGACCAATACTGGCTCAGAGTCTCGCTAGAAACATAGGGGGAAATGCATCACGC
AGCGAGTTAGACAAACTAAGCGAGCCATTGAAAAAGTTGGTCGTGCGTCATCCAATGGCGAAGGAATGGCTTCAG
CTTGGACTCAATCATGAGTCTTTTCCGAGCACTCAAGTCACCTCTGAACAGAAGGCCCTTCTTGTAAGAAAGATC
ATAAGCTTGAGAGGCTCCCGAGCCACAAACCAGGTCATACGAGAATTCTGGCTCACGTCGAGGGGCAGCAACTTT
GCATATGCGTCTTGA
Transcript >Ophun1|7341
ATGACCGCTCCCTGTGCTTGCTGGCTAACCTCCACCGAGCTGATACTGAGCCTCTATCAACCCAACTCACCGCAA
ATAATCGCCGATGCACAAGCGTGTCTATCGCGATTCCAAGGCTCACCGCAGGCATGGATCATGATTCAGGATCTT
CTTCAAAGACCCGACGAAAATGTGAAGTTCTTCGGCGCCTTGACGGTCATCATCAAGCTTAACAAGGAGAGCTCC
GCTCTAAGTAATGAAGATGCAATCGAGCTTCTCGTTCGCTTGGTGGGGTGGTACATCCGCTCTTTGGTCCATTCG
GACAGTCACATGGTGCTGAGGAAGCTATCTTCCGCAATCGCGACGTATTTCATTCATTTCCATCACCTGTGGCCT
CTATACCTTCGCCACATCGTTCTCTGCTTGGCTTGTGGTCAATCTTTGAACCCTCTGGAGACTCGTGAACTCAAC
GAGCTCTCGTCTGCGCTGAGCAGTCTGTGTCCGCGGCGATTGCAAGCCGCCGTGTGGGTGGTCACTTGTGTCATG
GAAGACGCTTCCAGGATCGACTTGAGCGCGGGTAATAAAAGCCTCTACGAGGCCATCTTGCGCAATGTTCCAGAA
GCAGTGGCCCTTGTGACCAAGTGCCTATCATCTGACAACACTGCGGCAGCTCTTTCTGTCGAATCCTTACGATGC
GTTCAAGCATGGATCATTTTTGCCCAAAAAACGTCCCCCGGGCTTACCCATGACACTCTGTCTTTGAGGCCCCTG
ATTGAAGCAGTCATACTGTCGCTTTCGGACAAGGATACGTTTGAAGCTTCGGCGGAGCTGCTCGTAGACATCCTA
ACCAACTGCCCGTTGCTTCTAACCAGTGAACACTACGACAACTTGAGCAAGCAATTGGGGGCCCTTTGGGCTGTC
GAACGTTATCATAGACTGCTTCGGGGCGACTTCGACCCTGAATCTATGCAGTTTGGGCAGCTTCTCATAGCATTC
GGTGAGGCGAGGACGGAGGCTCTGATACAGACCAACGACGAAATCCACAACCATATTCTGTCCGCGCTTTGTGGT
CTTCTAACTGTTCACGGATATCTTATAATGGAGGACAAGATCTTCGTTTCTGCAGTAGAATTTTGGTCAACATAT
ACGGAGGCTGTGGCAGATATCATTCATTTCGGGTCAGATGATGATGTATCGGATGCACGGGTCTCTGGCGCCACA
TCTCACGTCTCCAAGGCGGTTTTCAGCGTTTGGCAAAAGATCATATATCCCCCGCCCGAGGTATTTCAGCAGTGG
GATTCCGGCGATCGCGCAGGATTCAACGACGCACGAAAAGACGTATTGGACCTCTTACAGTCTGCACATACTGTG
CTCGGACCTGGGCTCATCGCGAGTTTTGCGGATCTCGTTCTCTCCGCATTGGAAAGCTCGGCATGGCTGCCATTG
GAGGCTGCAACATTCTGTCTTGGAGGCTTGGCGGAGTGTGGCAAAGGAGACGGGCGCTTCGATGAGGCTTTGACT
TCCGTCTTCGCCTCGCCTCTTACCTCAATCCTTCAATCGAGGGACCCCGACATAGACTTGCGTGCTCGGCAGTCA
TGCTTCTATCTAATAGAACAGTACGCAGAATATTTCGAACGCAACACTACACTCCTCGGCCCTGTTCTGCGCCTA
TTATTCGAGGTGCTGAGCGACCAGTCTACCGCTGCATCTGCCTCAAGATCGATACTGTTATTGTGCTCCTCCTGC
CGGCATCATCTCCATCCTCAAATCGACGAATTTCTCCTTGTTTACTCGGTCAAGGTCATTGAGAATCGGCTAGAC
TGCGTTTCGAACGAAAAGGTGCTCGGAGCAATCGCCTCCATTGCGCAGGCTATCCCGAATGCCGAGCGACGTCAT
GGCGTGTGTATGATGATTCTGGAATTTGTACAGAACGACGTAGCTCTGGCTCAGGCAGTGACCACATCGGCAGAA
GCGGCAAACTTCCGCTGCCAGGTGTTGCGATGTCCAAGGATCGTGGCTGACGAAGATCCGGCAACTCACACCGGC
CTGCGAGCACTGAAGTGTCTCGTGAGTGTGGGGAAGGGTTACCAGTCCCCGTGTGATGTCACGATCGACATCGAG
GGCAACAATCAGCAAGATGAAGTCATTGGCGATGCTCTGCCCCTTATACATGACAAATTGATGAGCATCATTGTC
GAACTTCAGCATACGTTCCCCAGGAGTTCGGAAGTTATGGAGCTTGTTTGCAGCGTTTTCCGCTATCCAGACCAC
GATCCGGAGCTATCCCAGAATGGAATCGAGTTGGCCTCACGGATCTTGTCCAGAGCTCCACTCGTAGTTCTTGGC
CTGCAGCCTCCAGAGGCGGCAGAATTCCTCTTGATGTTCACCATCAAAGTCCTTGATGGAAGGGAGCCCCTACCG
AAAGGTGCCGCTGCCGAATTTTGGACTGCATTTGTGAGCCTCAAGAGCGACGACGGAAATGTCGAGCCAGCGATG
AGGCGTGCCATGCAAACTCTAGGACCAATACTGGCTCAGAGTCTCGCTAGAAACATAGGGGGAAATGCATCACGC
AGCGAGTTAGACAAACTAAGCGAGCCATTGAAAAAGTTGGTCGTGCGTCATCCAATGGCGAAGGAATGGCTTCAG
CTTGGACTCAATCATGAGTCTTTTCCGAGCACTCAAGTCACCTCTGAACAGAAGGCCCTTCTTGTAAGAAAGATC
ATAAGCTTGAGAGGCTCCCGAGCCACAAACCAGGTCATACGAGAATTCTGGCTCACGTCGAGGGGCAGCAACTTT
GCATATGCGTCTTGA
Gene >Ophun1|7341
ATGACCGCTCCCTGTGCTTGCTGGCTAACCTCCACCGAGCTGATACTGAGCCTCTATCAACCCAACTCACCGCAA
ATAATCGCCGATGCACAAGCGTGTCTATCGCGATTCCAAGGCTCACCGCAGGCATGGATCATGATTCAGGATCTT
CTTCAAAGACCCGACGAAAATGTGAAGTTCTTCGGCGCCTTGACGGTCATCATCAAGCTTAACAAGGAGAGGTGC
GCTAAAGCAACGAAGCTCCCAACTGCGCATATAAGTCTTCTGACGAGCCCATCACAGCTCCGCTCTAAGTAATGA
AGATGCAATCGAGCTTCTCGTTCGCTTGGTGGGGTGGTACATCCGCTCTTTGGTCCATTCGGACAGTCACATGGT
GCTGAGGAAGCTATCTTCCGCAATCGCGACGTATTTCATTCATTTCCATCACCTGTGGCCTCTATACCTTCGCCA
CATCGTTCTCTGCTTGGCTTGTGGTCAATCTTTGAACCCTCTGGAGACTCGTGAACTCAACGAGCTCTCGTCTGC
GCTGAGCAGTCTGTGTCCGCGGCGATTGCAAGCCGCCGTGTGGGTGGTCACTTGTGTCATGGAAGACGCTTCCAG
GATCGACTTGAGCGCGGGTAATAAGTACGTCAGTTCCGGTCCCTGACTACATCAGTCAAAAGACGCGTATCAAGC
GGCGACTCACATTGGCGGCAGAAGCCTCTACGAGGCCATCTTGCGCAATGTTCCAGAAGCAGTGGCCCTTGTGAC
CAAGTGCCTATCATCTGACAACACTGCGGCAGCTCTTTCTGTCGAATCCTTACGATGCGTTCAAGTATGACCTTT
CCGGGTACCTTGCCTTTGGATATGCAGATATTTTTGTTGACTTGGCGACTACAGGCATGGATCATTTTTGCCCAA
AAAACGTCCCCCGGGCTTACCCATGACACTCTGTCTTTGAGGCCCCTGATTGAAGCAGTCATACTGTCGCTTTCG
GACAAGGATACGTTTGAAGCTTCGGCGGAGCTGCTCGTAGACATCCTAACCAACTGCCCGTTGCTTCTAACCAGT
GAACACTACGACAACTTGAGCAAGCAATTGGGGGCCCTTTGGGCTGTCGAACGTTATCATAGACTGCTTCGGGGC
GACTTCGACCCTGAATCTATGCAGTTTGGGCAGCTTCTCATAGCATTCGGTGAGGCGAGGACGGAGGCTCTGATA
CAGACCAACGACGAAATCCACAACCATATTCTGTCCGCGCTTTGTGGTCTTCTAACTGTTCACGGATATCTTATA
ATGGAGGACAAGATCTTCGTTTCTGCAGTAGAATTTTGGTCAACATATACGGAGGCTGTGGCAGATATCATTCAT
TTCGGGTCAGATGATGATGTATCGGATGCACGGGTCTCTGGCGCCACATCTCACGTCTCCAAGGCGGTTTTCAGC
GTTTGGCAAAAGATCATATATCCCCCGCCCGAGGTATTTCAGCAGTGGGATTCCGGCGATCGCGCAGGATTCAAC
GACGCACGAAAAGACGTATTGGACCTCTTACAGTCTGCACATACTGTGCTCGGACCTGGGCTCATCGCGAGTTTT
GCGGATCTCGTTCTCTCCGCATTGGAAAGCTCGGCATGGCTGCCATTGGAGGCTGCAACATTCTGTCTTGGAGGC
TTGGCGGAGTGTGGCAAAGGAGACGGGCGCTTCGATGAGGCTTTGACTTCCGTCTTCGCCTCGCCTCTTACCTCA
ATCCTTCAATCGAGGGACCCCGACATAGACTTGCGTGCTCGGCAGTCATGCTTCTATCTAATAGAACAGTACGCA
GAATATTTCGAACGCAACACTACACTCCTCGGCCCTGTTCTGCGCCTATTATTCGAGGTGCTGAGCGACCAGTCT
ACCGCTGCATCTGCCTCAAGATCGATACTGTTATTGTGCTCCTCCTGCCGGCATCATCTCCATCCTCAAATCGAC
GAATTTCTCCTTGTTTACTCGGTCAAGGTCATTGAGAATCGGCTAGACTGCGTTTCGAACGAAAAGGTGCTCGGA
GCAATCGCCTCCATTGCGCAGGCTATCCCGAATGCCGAGCGACGTCATGGCGTGTGTATGATGATTCTGGAATTT
GTACAGAACGACGTAGCTCTGGCTCAGGCAGTGACCACATCGGCAGAAGCGGCAAACTTCCGCTGCCAGGTGTTG
CGATGTCCAAGGATCGTGGCTGACGAAGATCCGGCAACTCACACCGGCCTGCGAGCACTGAAGTGTCTCGTGAGT
GTGGGGAAGGGTTACCAGTCCCCGTGTGATGTCACGATCGACATCGAGGGCAACAATCAGCAAGATGAAGTCATT
GGCGATGCTCTGCCCCTTATACATGACAAATTGATGAGCATCATTGTCGAACTTCAGCATACGTTCCCCAGGAGT
TCGGAAGTTATGGAGCTTGTTTGCAGCGTTTTCCGCTGTGGGTTTTCAGAAGTTGAACCTGGCCCTTTCGCCCTG
CAACCGGAGGTGGTCGCCATGTTTTTGACAGGCAACGGCGGAGAGACGCAAAGAATAGGTTTTTTTGTCGGCACA
GCTTGTTCTTTGGTGAGCTCCGTGCGCTGCAATAACTCTCCGAAAAGGCAAACAATCTTGGCCTCTTTGCTCCTT
TGGGCAGTGAGCCTCCTCCGACAACTACCAGGTGATACGACATATCTCGCCGTGGATGAAGAGATGATATCTAAC
ATGTGAATTTTCAGATCCAGACCACGATCCGGAGCTATCCCAGAATGGAATCGAGTTGGCCTCACGGATCTTGTC
CAGAGCTCCACTCGTAGTTCTTGGCCTGCAGCCTCCAGAGGCGGCAGAATTCCTCTTGATGTTCACCATCAAAGT
CCTTGATGGAAGGGAGCCCCTACCGAAAGGTGCCGCTGCCGAATTTTGGGTATGTCGAGCAGTCTCATCTACGAC
GTTGGGTGCATGCTTATGACGCCGTGAAGACTGCATTTGTGAGCCTCAAGAGCGACGACGGAAATGTCGAGCCAG
CGATGAGGCGTGCCATGCAAACTCTAGGACCAATACTGGCTCAGAGTCTCGCTAGAAACATAGGGGGAAATGCAT
CACGCAGCGAGTTAGACAAACTAAGCGAGCCATTGAAAAAGTTGGTCGTGCGTCATCCAATGGCGAAGGAATGGC
TTCAGCTTGGACTCAATCATGAGTCTTTTCCGAGCACTCAAGTCACCTCTGAACAGAAGGCCCTTCTTGTAAGAA
AGATCATAAGGTTAGTGATGGTTGCTGGTCATTTCGGGTCGGCGGAATGTATTAACTCATGTGGGTAGCTTGAGA
GGCTCCCGAGCCACAAACCAGGTCATACGAGAATTCTGGCTCACGTCGAGGGGCAGCAACTTTGCATATGCGTCT
TGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail