Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7338
Gene name
LocationContig_902:3787..5123
Strand-
Gene length (bp)1336
Transcript length (bp)1191
Coding sequence length (bp)1191
Protein length (aa) 397

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00226 DnaJ DnaJ domain 1.2E-10 41 75

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9P7C1|YKU3_SCHPO Uncharacterized J domain-containing protein C2E1P5.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2E1P5.03 PE=3 SV=1 8 186 7.0E-28
sp|Q96KC8|DNJC1_HUMAN DnaJ homolog subfamily C member 1 OS=Homo sapiens GN=DNAJC1 PE=1 SV=1 13 167 3.0E-10
sp|Q61712|DNJC1_MOUSE DnaJ homolog subfamily C member 1 OS=Mus musculus GN=Dnajc1 PE=1 SV=1 40 167 5.0E-09
sp|Q52702|DNAJ_RHOCA Chaperone protein DnaJ OS=Rhodobacter capsulatus GN=dnaJ PE=3 SV=1 38 71 9.0E-06

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 20 0.999679

Transmembrane Domains

Domain # Start End Length
1 5 22 17
2 145 167 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4668
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6068
Ophiocordyceps australis map64 (Brazil) OphauB2|1688
Ophiocordyceps camponoti-floridani Ophcf2|00387
Ophiocordyceps camponoti-rufipedis Ophun1|7338 (this protein)
Ophiocordyceps kimflemingae Ophio5|4901
Ophiocordyceps subramaniannii Hirsu2|9838

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7338
MRVAHVSVGLLLALVAPAIAGWSKEGEDEITAHEPDPKATFYDILGVSRGASQEDINRAYRKKSRSLHPDKVTQQ
LKTDRARTRAKASASEIKVAVKRASERQARLSLIANILRGPSRDRYDHFLSHGFPLWKGTDYYYSRYRPGLGTVV
FGLFLMGGGGLHYLILYMSWKRQKEFVERYVRFARETAWGSGFGSIPGIDAAVADGGGGDDDTPPPVQPMNRRQR
RMQDKESRREDGSGRAKKKGRKAAAAAAQDSGPAPSGARKRVVAENGKILVVDSQGDVFLEEEDEDGVVNEFLLD
PNELRQPTFKDTAVVRVPLWLVESVTGRFRSKNEAEATDSDSAADDSDAPQRTPSTDSAGDDFELLDKSTDSLAK
VKTSGAQQQGSKPHKRRNKKR*
Coding >Ophun1|7338
ATGAGAGTCGCGCACGTGTCGGTCGGGCTGCTGCTGGCCCTCGTGGCGCCTGCGATTGCGGGCTGGAGCAAAGAA
GGCGAGGATGAGATTACCGCTCATGAGCCGGATCCCAAGGCTACGTTTTACGATATTCTCGGTGTGTCGCGTGGA
GCGTCGCAGGAGGACATCAACCGTGCCTATCGCAAGAAGTCGCGCTCGTTGCATCCGGATAAGGTGACGCAGCAG
CTCAAGACGGACCGGGCTCGAACGCGGGCCAAGGCTTCGGCTTCGGAGATCAAGGTGGCGGTTAAGCGCGCTTCG
GAGCGTCAGGCGCGCTTGTCGCTCATCGCCAATATCCTGCGAGGGCCATCGAGGGATCGCTACGATCACTTCCTC
AGTCATGGGTTCCCGCTGTGGAAGGGCACGGATTATTACTACTCTCGCTACCGGCCTGGTCTCGGCACTGTCGTC
TTCGGGCTCTTCCTGATGGGCGGTGGTGGATTGCACTATCTTATACTTTACATGAGCTGGAAGAGGCAGAAGGAG
TTTGTTGAGCGTTACGTTCGGTTTGCTCGCGAGACGGCTTGGGGTTCTGGCTTTGGCTCCATTCCGGGTATTGAT
GCTGCCGTGGCGGATGGTGGTGGCGGCGATGACGACACGCCGCCTCCGGTTCAGCCGATGAATAGGAGGCAGAGA
CGGATGCAGGATAAGGAGTCGAGACGCGAGGATGGCTCTGGCCGTGCCAAGAAGAAGGGTCGCAAGGCTGCTGCT
GCTGCCGCGCAGGATTCTGGCCCTGCTCCGTCTGGGGCGCGCAAGAGGGTGGTTGCTGAAAATGGCAAGATTCTC
GTCGTCGATTCTCAGGGCGATGTCTTTCTTGAAGAGGAGGATGAAGATGGCGTCGTCAACGAGTTTCTCCTCGAC
CCTAACGAGCTCCGCCAACCAACTTTCAAAGACACAGCCGTGGTCCGCGTGCCTCTCTGGCTTGTCGAGTCCGTC
ACCGGCCGTTTCCGCTCCAAGAACGAGGCCGAAGCCACCGACTCGGACTCGGCAGCCGACGACTCAGACGCTCCG
CAGCGAACCCCGAGCACCGACTCAGCCGGCGACGACTTCGAACTCCTCGACAAGAGCACCGACTCGCTGGCCAAG
GTCAAGACTTCGGGGGCGCAGCAGCAGGGGTCGAAGCCTCACAAGAGGAGGAATAAGAAGCGCTAG
Transcript >Ophun1|7338
ATGAGAGTCGCGCACGTGTCGGTCGGGCTGCTGCTGGCCCTCGTGGCGCCTGCGATTGCGGGCTGGAGCAAAGAA
GGCGAGGATGAGATTACCGCTCATGAGCCGGATCCCAAGGCTACGTTTTACGATATTCTCGGTGTGTCGCGTGGA
GCGTCGCAGGAGGACATCAACCGTGCCTATCGCAAGAAGTCGCGCTCGTTGCATCCGGATAAGGTGACGCAGCAG
CTCAAGACGGACCGGGCTCGAACGCGGGCCAAGGCTTCGGCTTCGGAGATCAAGGTGGCGGTTAAGCGCGCTTCG
GAGCGTCAGGCGCGCTTGTCGCTCATCGCCAATATCCTGCGAGGGCCATCGAGGGATCGCTACGATCACTTCCTC
AGTCATGGGTTCCCGCTGTGGAAGGGCACGGATTATTACTACTCTCGCTACCGGCCTGGTCTCGGCACTGTCGTC
TTCGGGCTCTTCCTGATGGGCGGTGGTGGATTGCACTATCTTATACTTTACATGAGCTGGAAGAGGCAGAAGGAG
TTTGTTGAGCGTTACGTTCGGTTTGCTCGCGAGACGGCTTGGGGTTCTGGCTTTGGCTCCATTCCGGGTATTGAT
GCTGCCGTGGCGGATGGTGGTGGCGGCGATGACGACACGCCGCCTCCGGTTCAGCCGATGAATAGGAGGCAGAGA
CGGATGCAGGATAAGGAGTCGAGACGCGAGGATGGCTCTGGCCGTGCCAAGAAGAAGGGTCGCAAGGCTGCTGCT
GCTGCCGCGCAGGATTCTGGCCCTGCTCCGTCTGGGGCGCGCAAGAGGGTGGTTGCTGAAAATGGCAAGATTCTC
GTCGTCGATTCTCAGGGCGATGTCTTTCTTGAAGAGGAGGATGAAGATGGCGTCGTCAACGAGTTTCTCCTCGAC
CCTAACGAGCTCCGCCAACCAACTTTCAAAGACACAGCCGTGGTCCGCGTGCCTCTCTGGCTTGTCGAGTCCGTC
ACCGGCCGTTTCCGCTCCAAGAACGAGGCCGAAGCCACCGACTCGGACTCGGCAGCCGACGACTCAGACGCTCCG
CAGCGAACCCCGAGCACCGACTCAGCCGGCGACGACTTCGAACTCCTCGACAAGAGCACCGACTCGCTGGCCAAG
GTCAAGACTTCGGGGGCGCAGCAGCAGGGGTCGAAGCCTCACAAGAGGAGGAATAAGAAGCGCTAG
Gene >Ophun1|7338
ATGAGAGTCGCGCACGTGTCGGTCGGGCTGCTGCTGGCCCTCGTGGCGCCTGCGATTGCGGGCTGGAGCAAAGAA
GGCGAGTCTGTGGCTTTCTCTTGATTTCTCCCGTTCGTCTTCTGACTTGTGGGAGCGGTAGATCGGGAAATCTTT
CGTATCAGGGATGAGATTACCGCTCATGAGCCGGATCCCAAGGCTACGTTTTACGATATTCTCGGTGTGTCGCGT
GGAGCGTCGCAGGAGGACATCAACCGTGCCTATCGCAAGAAGTCGCGCTCGTTGCATCCGGATAAGGTGACGCAG
CAGCTCAAGACGGACCGGGCTCGAACGCGGGCCAAGGCTTCGGCTTCGGAGATCAAGGTGGCGGTTAAGCGCGCT
TCGGAGCGTCAGGCGCGCTTGTCGCTCATCGCCAATATCCTGCGAGGGCCATCGAGGGATCGCTACGATCACTTC
CTCAGTCATGGGTTCCCGCTGTGGAAGGGCACGGATTATTACTACTCTCGCTACCGGCCTGGTCTCGGCACTGTC
GTCTTCGGGCTCTTCCTGATGGGCGGTGGTGGATTGCACTATCTTATACTTTACATGAGCTGGAAGAGGCAGAAG
GAGTTTGTTGAGCGTTACGTTCGGTTTGCTCGCGAGACGGCTTGGGGTTCTGGCTTTGGCTCCATTCCGGGTATT
GATGCTGCCGTGGCGGATGGTGGTGGCGGCGATGACGACACGCCGCCTCCGGTTCAGCCGATGAATAGGAGGCAG
AGACGGATGCAGGATAAGGAGTCGAGACGCGAGGATGGCTCTGGCCGTGCCAAGAAGAAGGGTCGCAAGGCTGCT
GCTGCTGCCGCGCAGGATTCTGGCCCTGCTCCGTCTGGGGCGCGCAAGAGGGTGGTTGCTGAAAATGGCAAGATT
CTCGTCGTCGATTCTCAGGGCGATGTCTTTCTTGAAGAGGAGGATGAAGATGGCGTCGTCAACGAGTTTCTCCTC
GACGTGAGCCGCTGAAACCTCCCTCTCGCGTGGGAGAAAATCTCGCTGACCCGATCGGAAACTCACACAGCCTAA
CGAGCTCCGCCAACCAACTTTCAAAGACACAGCCGTGGTCCGCGTGCCTCTCTGGCTTGTCGAGTCCGTCACCGG
CCGTTTCCGCTCCAAGAACGAGGCCGAAGCCACCGACTCGGACTCGGCAGCCGACGACTCAGACGCTCCGCAGCG
AACCCCGAGCACCGACTCAGCCGGCGACGACTTCGAACTCCTCGACAAGAGCACCGACTCGCTGGCCAAGGTCAA
GACTTCGGGGGCGCAGCAGCAGGGGTCGAAGCCTCACAAGAGGAGGAATAAGAAGCGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail