Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7338
Gene name
LocationContig_902:3787..5123
Strand-
Gene length (bp)1336
Transcript length (bp)1191
Coding sequence length (bp)1191
Protein length (aa) 397

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00226 DnaJ DnaJ domain 1.2E-10 41 75

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9P7C1|YKU3_SCHPO Uncharacterized J domain-containing protein C2E1P5.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2E1P5.03 PE=3 SV=1 8 186 7.0E-28
sp|Q96KC8|DNJC1_HUMAN DnaJ homolog subfamily C member 1 OS=Homo sapiens GN=DNAJC1 PE=1 SV=1 13 167 3.0E-10
sp|Q61712|DNJC1_MOUSE DnaJ homolog subfamily C member 1 OS=Mus musculus GN=Dnajc1 PE=1 SV=1 40 167 5.0E-09
sp|Q52702|DNAJ_RHOCA Chaperone protein DnaJ OS=Rhodobacter capsulatus GN=dnaJ PE=3 SV=1 38 71 9.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 5 22 17
2 145 167 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7338
MRVAHVSVGLLLALVAPAIAGWSKEGEDEITAHEPDPKATFYDILGVSRGASQEDINRAYRKKSRSLHPDKVTQQ
LKTDRARTRAKASASEIKVAVKRASERQARLSLIANILRGPSRDRYDHFLSHGFPLWKGTDYYYSRYRPGLGTVV
FGLFLMGGGGLHYLILYMSWKRQKEFVERYVRFARETAWGSGFGSIPGIDAAVADGGGGDDDTPPPVQPMNRRQR
RMQDKESRREDGSGRAKKKGRKAAAAAAQDSGPAPSGARKRVVAENGKILVVDSQGDVFLEEEDEDGVVNEFLLD
PNELRQPTFKDTAVVRVPLWLVESVTGRFRSKNEAEATDSDSAADDSDAPQRTPSTDSAGDDFELLDKSTDSLAK
VKTSGAQQQGSKPHKRRNKKR*
Coding >Ophun1|7338
ATGAGAGTCGCGCACGTGTCGGTCGGGCTGCTGCTGGCCCTCGTGGCGCCTGCGATTGCGGGCTGGAGCAAAGAA
GGCGAGGATGAGATTACCGCTCATGAGCCGGATCCCAAGGCTACGTTTTACGATATTCTCGGTGTGTCGCGTGGA
GCGTCGCAGGAGGACATCAACCGTGCCTATCGCAAGAAGTCGCGCTCGTTGCATCCGGATAAGGTGACGCAGCAG
CTCAAGACGGACCGGGCTCGAACGCGGGCCAAGGCTTCGGCTTCGGAGATCAAGGTGGCGGTTAAGCGCGCTTCG
GAGCGTCAGGCGCGCTTGTCGCTCATCGCCAATATCCTGCGAGGGCCATCGAGGGATCGCTACGATCACTTCCTC
AGTCATGGGTTCCCGCTGTGGAAGGGCACGGATTATTACTACTCTCGCTACCGGCCTGGTCTCGGCACTGTCGTC
TTCGGGCTCTTCCTGATGGGCGGTGGTGGATTGCACTATCTTATACTTTACATGAGCTGGAAGAGGCAGAAGGAG
TTTGTTGAGCGTTACGTTCGGTTTGCTCGCGAGACGGCTTGGGGTTCTGGCTTTGGCTCCATTCCGGGTATTGAT
GCTGCCGTGGCGGATGGTGGTGGCGGCGATGACGACACGCCGCCTCCGGTTCAGCCGATGAATAGGAGGCAGAGA
CGGATGCAGGATAAGGAGTCGAGACGCGAGGATGGCTCTGGCCGTGCCAAGAAGAAGGGTCGCAAGGCTGCTGCT
GCTGCCGCGCAGGATTCTGGCCCTGCTCCGTCTGGGGCGCGCAAGAGGGTGGTTGCTGAAAATGGCAAGATTCTC
GTCGTCGATTCTCAGGGCGATGTCTTTCTTGAAGAGGAGGATGAAGATGGCGTCGTCAACGAGTTTCTCCTCGAC
CCTAACGAGCTCCGCCAACCAACTTTCAAAGACACAGCCGTGGTCCGCGTGCCTCTCTGGCTTGTCGAGTCCGTC
ACCGGCCGTTTCCGCTCCAAGAACGAGGCCGAAGCCACCGACTCGGACTCGGCAGCCGACGACTCAGACGCTCCG
CAGCGAACCCCGAGCACCGACTCAGCCGGCGACGACTTCGAACTCCTCGACAAGAGCACCGACTCGCTGGCCAAG
GTCAAGACTTCGGGGGCGCAGCAGCAGGGGTCGAAGCCTCACAAGAGGAGGAATAAGAAGCGCTAG
Transcript >Ophun1|7338
ATGAGAGTCGCGCACGTGTCGGTCGGGCTGCTGCTGGCCCTCGTGGCGCCTGCGATTGCGGGCTGGAGCAAAGAA
GGCGAGGATGAGATTACCGCTCATGAGCCGGATCCCAAGGCTACGTTTTACGATATTCTCGGTGTGTCGCGTGGA
GCGTCGCAGGAGGACATCAACCGTGCCTATCGCAAGAAGTCGCGCTCGTTGCATCCGGATAAGGTGACGCAGCAG
CTCAAGACGGACCGGGCTCGAACGCGGGCCAAGGCTTCGGCTTCGGAGATCAAGGTGGCGGTTAAGCGCGCTTCG
GAGCGTCAGGCGCGCTTGTCGCTCATCGCCAATATCCTGCGAGGGCCATCGAGGGATCGCTACGATCACTTCCTC
AGTCATGGGTTCCCGCTGTGGAAGGGCACGGATTATTACTACTCTCGCTACCGGCCTGGTCTCGGCACTGTCGTC
TTCGGGCTCTTCCTGATGGGCGGTGGTGGATTGCACTATCTTATACTTTACATGAGCTGGAAGAGGCAGAAGGAG
TTTGTTGAGCGTTACGTTCGGTTTGCTCGCGAGACGGCTTGGGGTTCTGGCTTTGGCTCCATTCCGGGTATTGAT
GCTGCCGTGGCGGATGGTGGTGGCGGCGATGACGACACGCCGCCTCCGGTTCAGCCGATGAATAGGAGGCAGAGA
CGGATGCAGGATAAGGAGTCGAGACGCGAGGATGGCTCTGGCCGTGCCAAGAAGAAGGGTCGCAAGGCTGCTGCT
GCTGCCGCGCAGGATTCTGGCCCTGCTCCGTCTGGGGCGCGCAAGAGGGTGGTTGCTGAAAATGGCAAGATTCTC
GTCGTCGATTCTCAGGGCGATGTCTTTCTTGAAGAGGAGGATGAAGATGGCGTCGTCAACGAGTTTCTCCTCGAC
CCTAACGAGCTCCGCCAACCAACTTTCAAAGACACAGCCGTGGTCCGCGTGCCTCTCTGGCTTGTCGAGTCCGTC
ACCGGCCGTTTCCGCTCCAAGAACGAGGCCGAAGCCACCGACTCGGACTCGGCAGCCGACGACTCAGACGCTCCG
CAGCGAACCCCGAGCACCGACTCAGCCGGCGACGACTTCGAACTCCTCGACAAGAGCACCGACTCGCTGGCCAAG
GTCAAGACTTCGGGGGCGCAGCAGCAGGGGTCGAAGCCTCACAAGAGGAGGAATAAGAAGCGCTAG
Gene >Ophun1|7338
ATGAGAGTCGCGCACGTGTCGGTCGGGCTGCTGCTGGCCCTCGTGGCGCCTGCGATTGCGGGCTGGAGCAAAGAA
GGCGAGTCTGTGGCTTTCTCTTGATTTCTCCCGTTCGTCTTCTGACTTGTGGGAGCGGTAGATCGGGAAATCTTT
CGTATCAGGGATGAGATTACCGCTCATGAGCCGGATCCCAAGGCTACGTTTTACGATATTCTCGGTGTGTCGCGT
GGAGCGTCGCAGGAGGACATCAACCGTGCCTATCGCAAGAAGTCGCGCTCGTTGCATCCGGATAAGGTGACGCAG
CAGCTCAAGACGGACCGGGCTCGAACGCGGGCCAAGGCTTCGGCTTCGGAGATCAAGGTGGCGGTTAAGCGCGCT
TCGGAGCGTCAGGCGCGCTTGTCGCTCATCGCCAATATCCTGCGAGGGCCATCGAGGGATCGCTACGATCACTTC
CTCAGTCATGGGTTCCCGCTGTGGAAGGGCACGGATTATTACTACTCTCGCTACCGGCCTGGTCTCGGCACTGTC
GTCTTCGGGCTCTTCCTGATGGGCGGTGGTGGATTGCACTATCTTATACTTTACATGAGCTGGAAGAGGCAGAAG
GAGTTTGTTGAGCGTTACGTTCGGTTTGCTCGCGAGACGGCTTGGGGTTCTGGCTTTGGCTCCATTCCGGGTATT
GATGCTGCCGTGGCGGATGGTGGTGGCGGCGATGACGACACGCCGCCTCCGGTTCAGCCGATGAATAGGAGGCAG
AGACGGATGCAGGATAAGGAGTCGAGACGCGAGGATGGCTCTGGCCGTGCCAAGAAGAAGGGTCGCAAGGCTGCT
GCTGCTGCCGCGCAGGATTCTGGCCCTGCTCCGTCTGGGGCGCGCAAGAGGGTGGTTGCTGAAAATGGCAAGATT
CTCGTCGTCGATTCTCAGGGCGATGTCTTTCTTGAAGAGGAGGATGAAGATGGCGTCGTCAACGAGTTTCTCCTC
GACGTGAGCCGCTGAAACCTCCCTCTCGCGTGGGAGAAAATCTCGCTGACCCGATCGGAAACTCACACAGCCTAA
CGAGCTCCGCCAACCAACTTTCAAAGACACAGCCGTGGTCCGCGTGCCTCTCTGGCTTGTCGAGTCCGTCACCGG
CCGTTTCCGCTCCAAGAACGAGGCCGAAGCCACCGACTCGGACTCGGCAGCCGACGACTCAGACGCTCCGCAGCG
AACCCCGAGCACCGACTCAGCCGGCGACGACTTCGAACTCCTCGACAAGAGCACCGACTCGCTGGCCAAGGTCAA
GACTTCGGGGGCGCAGCAGCAGGGGTCGAAGCCTCACAAGAGGAGGAATAAGAAGCGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail