Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7335
Gene name
LocationContig_901:696..4173
Strand-
Gene length (bp)3477
Transcript length (bp)3159
Coding sequence length (bp)3159
Protein length (aa) 1053

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01399 PCI PCI domain 9.1E-09 399 520

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6C161|EIF3A_YARLI Eukaryotic translation initiation factor 3 subunit A OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TIF32 PE=3 SV=1 5 1036 0.0E+00
sp|Q2H6G4|EIF3A_CHAGB Eukaryotic translation initiation factor 3 subunit A OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=TIF32 PE=3 SV=1 1 1035 0.0E+00
sp|Q59PL9|EIF3A_CANAL Eukaryotic translation initiation factor 3 subunit A OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPG1A PE=3 SV=2 4 831 0.0E+00
sp|A5E1T3|EIF3A_LODEL Eukaryotic translation initiation factor 3 subunit A OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=TIF32 PE=3 SV=1 3 893 0.0E+00
sp|A5DHL9|EIF3A_PICGU Eukaryotic translation initiation factor 3 subunit A OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=TIF32 PE=3 SV=2 3 912 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6C161|EIF3A_YARLI Eukaryotic translation initiation factor 3 subunit A OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TIF32 PE=3 SV=1 5 1036 0.0E+00
sp|Q2H6G4|EIF3A_CHAGB Eukaryotic translation initiation factor 3 subunit A OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=TIF32 PE=3 SV=1 1 1035 0.0E+00
sp|Q59PL9|EIF3A_CANAL Eukaryotic translation initiation factor 3 subunit A OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPG1A PE=3 SV=2 4 831 0.0E+00
sp|A5E1T3|EIF3A_LODEL Eukaryotic translation initiation factor 3 subunit A OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=TIF32 PE=3 SV=1 3 893 0.0E+00
sp|A5DHL9|EIF3A_PICGU Eukaryotic translation initiation factor 3 subunit A OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=TIF32 PE=3 SV=2 3 912 0.0E+00
sp|B5RUP5|EIF3A_DEBHA Eukaryotic translation initiation factor 3 subunit A OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TIF32 PE=3 SV=1 4 863 0.0E+00
sp|O74760|EIF3A_SCHPO Eukaryotic translation initiation factor 3 subunit A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif32 PE=1 SV=1 4 1037 0.0E+00
sp|Q4P358|EIF3A_USTMA Eukaryotic translation initiation factor 3 subunit A OS=Ustilago maydis (strain 521 / FGSC 9021) GN=TIF32 PE=3 SV=2 4 984 0.0E+00
sp|A1CRE5|EIF3A_ASPCL Eukaryotic translation initiation factor 3 subunit A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=tif32 PE=3 SV=1 1 823 0.0E+00
sp|A2Q8I1|EIF3A_ASPNC Eukaryotic translation initiation factor 3 subunit A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=tif32 PE=3 SV=1 1 825 0.0E+00
sp|Q0CUP6|EIF3A_ASPTN Eukaryotic translation initiation factor 3 subunit A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=tif32 PE=3 SV=1 1 825 0.0E+00
sp|Q7RWT1|EIF3A_NEUCR Eukaryotic translation initiation factor 3 subunit A OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=eif3a PE=3 SV=3 1 978 0.0E+00
sp|A4RM69|EIF3A_MAGO7 Eukaryotic translation initiation factor 3 subunit A OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=TIF32 PE=3 SV=1 1 1038 0.0E+00
sp|Q5B9N7|EIF3A_EMENI Eukaryotic translation initiation factor 3 subunit A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tif32 PE=3 SV=2 1 1037 0.0E+00
sp|Q2UKG6|EIF3A_ASPOR Eukaryotic translation initiation factor 3 subunit A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tif32 PE=3 SV=1 1 826 0.0E+00
sp|A1D4A7|EIF3A_NEOFI Eukaryotic translation initiation factor 3 subunit A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=tif32 PE=3 SV=1 1 825 0.0E+00
sp|Q4WJQ1|EIF3A_ASPFU Eukaryotic translation initiation factor 3 subunit A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tif32 PE=3 SV=2 1 825 0.0E+00
sp|B0XP13|EIF3A_ASPFC Eukaryotic translation initiation factor 3 subunit A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=tif32 PE=3 SV=1 1 825 0.0E+00
sp|Q1DXU0|EIF3A_COCIM Eukaryotic translation initiation factor 3 subunit A OS=Coccidioides immitis (strain RS) GN=TIF32 PE=3 SV=2 1 1035 0.0E+00
sp|Q6PCR7|EIF3A_DANRE Eukaryotic translation initiation factor 3 subunit A OS=Danio rerio GN=eif3a PE=2 SV=1 3 856 8.0E-172
sp|A4II09|EIF3A_XENTR Eukaryotic translation initiation factor 3 subunit A OS=Xenopus tropicalis GN=eif3a PE=2 SV=1 3 805 9.0E-168
sp|A7SK48|EIF3A_NEMVE Eukaryotic translation initiation factor 3 subunit A OS=Nematostella vectensis GN=v1g190699 PE=3 SV=2 3 815 2.0E-165
sp|P23116|EIF3A_MOUSE Eukaryotic translation initiation factor 3 subunit A OS=Mus musculus GN=Eif3a PE=1 SV=5 3 835 2.0E-164
sp|A2VD00|EIF3A_XENLA Eukaryotic translation initiation factor 3 subunit A OS=Xenopus laevis GN=eif3a PE=2 SV=1 7 805 3.0E-164
sp|Q1JU68|EIF3A_RAT Eukaryotic translation initiation factor 3 subunit A OS=Rattus norvegicus GN=Eif3a PE=2 SV=2 3 805 4.0E-164
sp|Q14152|EIF3A_HUMAN Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens GN=EIF3A PE=1 SV=1 3 805 7.0E-164
sp|Q9LD55|EIF3A_ARATH Eukaryotic translation initiation factor 3 subunit A OS=Arabidopsis thaliana GN=TIF3A1 PE=1 SV=1 8 877 6.0E-148
sp|Q40554|EIF3A_TOBAC Eukaryotic translation initiation factor 3 subunit A OS=Nicotiana tabacum GN=TIF3A1 PE=2 SV=1 8 843 1.0E-139
sp|Q9XHR2|EIF3A_MAIZE Eukaryotic translation initiation factor 3 subunit A OS=Zea mays GN=TIF3A1 PE=2 SV=1 8 823 5.0E-137
sp|P0CN43|EIF3A_CRYNB Eukaryotic translation initiation factor 3 subunit A OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TIF32 PE=3 SV=1 3 824 5.0E-134
sp|P0CN42|EIF3A_CRYNJ Eukaryotic translation initiation factor 3 subunit A OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TIF32 PE=3 SV=1 3 824 5.0E-134
sp|B4K250|EIF3A_DROGR Eukaryotic translation initiation factor 3 subunit A OS=Drosophila grimshawi GN=eIF3-S10 PE=3 SV=1 7 827 1.0E-133
sp|Q173M7|EIF3A_AEDAE Eukaryotic translation initiation factor 3 subunit A OS=Aedes aegypti GN=eIF3-S10 PE=3 SV=1 7 807 1.0E-133
sp|B4QVI2|EIF3A_DROSI Eukaryotic translation initiation factor 3 subunit A OS=Drosophila simulans GN=eIF3-S10 PE=3 SV=1 7 827 3.0E-132
sp|B4PTS9|EIF3A_DROYA Eukaryotic translation initiation factor 3 subunit A OS=Drosophila yakuba GN=eIF3-S10 PE=3 SV=1 7 999 2.0E-131
sp|Q7PGE8|EIF3A_ANOGA Eukaryotic translation initiation factor 3 subunit A OS=Anopheles gambiae GN=eIF3-S10 PE=3 SV=5 7 816 3.0E-131
sp|B4I3P3|EIF3A_DROSE Eukaryotic translation initiation factor 3 subunit A OS=Drosophila sechellia GN=eIF3-S10 PE=3 SV=2 7 827 4.0E-131
sp|Q9VN25|EIF3A_DROME Eukaryotic translation initiation factor 3 subunit A OS=Drosophila melanogaster GN=eIF3-S10 PE=1 SV=1 7 826 6.0E-131
sp|B3LY22|EIF3A_DROAN Eukaryotic translation initiation factor 3 subunit A OS=Drosophila ananassae GN=eIF3-S10 PE=3 SV=1 7 952 1.0E-130
sp|B0W6N3|EIF3A_CULQU Eukaryotic translation initiation factor 3 subunit A OS=Culex quinquefasciatus GN=eIF3-S10 PE=3 SV=2 7 807 5.0E-130
sp|B3P211|EIF3A_DROER Eukaryotic translation initiation factor 3 subunit A OS=Drosophila erecta GN=eIF3-S10 PE=3 SV=1 7 826 6.0E-130
sp|Q6CT90|EIF3A_KLULA Eukaryotic translation initiation factor 3 subunit A OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TIF32 PE=3 SV=1 4 825 8.0E-130
sp|B4NIC3|EIF3A_DROWI Eukaryotic translation initiation factor 3 subunit A OS=Drosophila willistoni GN=eIF3-S10 PE=3 SV=1 7 827 7.0E-128
sp|P38249|EIF3A_YEAST Eukaryotic translation initiation factor 3 subunit A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPG1 PE=1 SV=1 1 851 7.0E-127
sp|B4GDX4|EIF3A_DROPE Eukaryotic translation initiation factor 3 subunit A OS=Drosophila persimilis GN=eIF3-S10 PE=3 SV=2 7 827 3.0E-126
sp|Q75DT8|EIF3A_ASHGO Eukaryotic translation initiation factor 3 subunit A OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TIF32 PE=3 SV=1 4 898 4.0E-126
sp|Q295G5|EIF3A_DROPS Eukaryotic translation initiation factor 3 subunit A OS=Drosophila pseudoobscura pseudoobscura GN=eIF3-S10 PE=3 SV=1 7 827 1.0E-125
sp|B4KA44|EIF3A_DROMO Eukaryotic translation initiation factor 3 subunit A OS=Drosophila mojavensis GN=eIF3-S10 PE=3 SV=1 7 810 2.0E-125
sp|B4M693|EIF3A_DROVI Eukaryotic translation initiation factor 3 subunit A OS=Drosophila virilis GN=eIF3-S10 PE=3 SV=1 7 785 4.0E-124
sp|A9V549|EIF3A_MONBE Eukaryotic translation initiation factor 3 subunit A OS=Monosiga brevicollis GN=33388 PE=3 SV=1 8 1018 2.0E-117
sp|Q6FK21|EIF3A_CANGA Eukaryotic translation initiation factor 3 subunit A OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TIF32 PE=3 SV=1 1 831 2.0E-113
sp|A7TL64|EIF3A_VANPO Eukaryotic translation initiation factor 3 subunit A OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=TIF32 PE=3 SV=1 4 831 2.0E-109
sp|A8PKH2|EIF3A_BRUMA Eukaryotic translation initiation factor 3 subunit A OS=Brugia malayi GN=Bm1_29045 PE=3 SV=1 1 959 5.0E-106
sp|P34339|EIF3A_CAEEL Eukaryotic translation initiation factor 3 subunit A OS=Caenorhabditis elegans GN=egl-45 PE=3 SV=1 1 736 2.0E-91
sp|A8WM57|EIF3A_CAEBR Eukaryotic translation initiation factor 3 subunit A OS=Caenorhabditis briggsae GN=egl-45 PE=3 SV=1 1 736 1.0E-89
sp|Q86B20|EIF3A_DICDI Eukaryotic translation initiation factor 3 subunit A OS=Dictyostelium discoideum GN=eif3A PE=1 SV=1 7 835 8.0E-65
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1897
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1821
Ophiocordyceps australis map64 (Brazil) OphauB2|2438
Ophiocordyceps camponoti-floridani Ophcf2|04495
Ophiocordyceps camponoti-rufipedis Ophun1|7335 (this protein)
Ophiocordyceps kimflemingae Ophio5|7904
Ophiocordyceps subramaniannii Hirsu2|1974

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7335
MPPPPHQKPENVLKRAHELIGVHQAQAALTLLHEHITSKRSRNAPIASLEPVMLLLVELSVEQKKGKLAKDALYQ
YKNISQNTNIATIELVLKKFIELAVEKVTAAQQKADEVQSSIDATAAATSSIDDLEASETPESILLATVSGEQSR
DRTDRAIVTPWLKFLWEAYRTVLDILRNNARLELLYQSTAMQAFDFCLKYTRKTEFRRLCELLRNHVQTAAKYSS
QMHAINLSDPDTLQRHLETRFQQLNVAVELELWQEAFRSVEDIHTLLNLSKRPPKNVMMANYYEKLTRIFLVGEN
YLFHAAAWSRYYSLLRQSAALVAGGQGKKADNPPASDADLQKAASFVLLSALAIPVISTTRSRGAMVDFDEAKKN
KNSRLTHLLGMNQAPTRARLFRDALSKSLLQRVRPEIRDLYNMLEVDFHPLSICQKISPILTKIGADAEMERYIV
PLQQVILTRLFQQLSQVYETIDVEFVEGLAQFPEPYQVTRSTIEKFIMNGNKKGDLAIRMDHATGVLSFDNDVFS
SAKAGQTGGSADSETGTVQRLQSTPSEIVRSQLTRLARSLYTTCHYIDPSFNKERLAARNAALARAKAGAEQEHL
EVLARKEVIQKRKEEATEMQAKRDKENARQKRLREQALQEAEDKRLAAEQKEREAKRLKAERDRVRKEELKKQIA
DLKMSDKALDIDLDDLDNLDANRLRAMKLAQLEREKNDVNERLRITGKRIDHLERAFRKEEGRKLHQDYAEQNEQ
DHAVYETLKAKTLREAEEKHKESVELKHRLSRLVPLYEGFRRSLHERRRDEFEKRRKDAERELEKQIAARKKEVR
DRKMREKREREEKERQLREAEERAAREKEEQRLRDEARKAEMAKLKEQRERERQETLEKAALQQRREEEALARRK
AEKERAPLASRPDMGDSRRPEAAAAAAGGGGYWRGSSNAEAPVRAAGDSKDRPSGPPKLQLAGGKPSWRDREAAK
AAASAAGGGGGGGGENGPEAATGGRTGGARPAREEENGGRTAPEPLPASRGGKWVPPHKRNQARTISSLVSVSGG
SL*
Coding >Ophun1|7335
ATGCCTCCTCCGCCGCATCAAAAGCCGGAAAATGTCCTCAAGCGCGCTCATGAGCTCATTGGGGTTCATCAGGCT
CAGGCTGCCTTGACCTTGCTGCATGAGCACATCACCAGCAAGCGCTCTCGCAATGCCCCGATCGCCTCGTTGGAG
CCTGTTATGCTCCTGTTGGTCGAGTTGTCGGTTGAGCAGAAAAAGGGCAAGCTGGCCAAGGATGCTCTCTACCAG
TACAAGAACATTTCGCAGAATACAAACATTGCCACCATCGAGCTCGTCCTCAAAAAGTTCATCGAGTTGGCCGTT
GAAAAGGTCACCGCCGCCCAGCAAAAGGCCGATGAGGTTCAGTCCAGCATCGATGCCACCGCCGCCGCCACCTCG
AGCATCGATGACCTCGAGGCCAGCGAGACGCCAGAGTCCATCCTCCTCGCAACCGTTTCGGGAGAGCAGTCGCGC
GATCGCACCGACCGCGCCATCGTCACCCCTTGGCTCAAGTTCTTGTGGGAGGCCTACCGTACCGTCCTCGACATC
CTCCGCAACAATGCCCGCCTGGAGCTCCTCTACCAGAGCACCGCCATGCAGGCCTTTGACTTTTGCCTCAAGTAC
ACGAGGAAGACGGAGTTTCGAAGGCTCTGCGAGCTGCTCCGCAACCACGTCCAGACGGCCGCAAAGTACTCGTCT
CAGATGCACGCCATCAATCTGAGCGACCCGGACACCCTCCAGCGCCACCTCGAGACCCGCTTCCAGCAGCTCAAC
GTCGCCGTCGAGCTCGAGCTGTGGCAGGAGGCCTTCCGCAGCGTCGAGGACATCCACACCCTCCTCAATCTCAGC
AAGAGGCCTCCCAAGAACGTCATGATGGCCAACTACTACGAGAAGCTGACCCGCATCTTCCTCGTCGGCGAAAAC
TACCTCTTCCACGCCGCCGCCTGGTCCAGGTACTACTCGCTGCTGCGACAGTCTGCCGCTCTGGTCGCCGGCGGC
CAGGGCAAAAAGGCCGACAACCCGCCCGCCTCCGACGCCGACCTCCAAAAGGCGGCCTCCTTCGTCCTCCTGTCC
GCGCTGGCCATACCCGTCATCAGCACCACCCGGTCCCGCGGCGCCATGGTCGACTTCGACGAGGCCAAGAAGAAC
AAGAACTCGCGCCTCACGCACCTGCTGGGCATGAACCAGGCGCCCACCCGGGCCAGGCTCTTCCGCGACGCCCTG
TCCAAGTCTCTCCTGCAGCGCGTCCGCCCCGAGATCCGCGACCTGTACAACATGCTCGAAGTCGACTTCCACCCT
CTTTCCATCTGCCAAAAGATCTCGCCCATCCTGACCAAGATCGGTGCAGACGCCGAGATGGAGCGCTACATCGTG
CCCCTGCAGCAGGTCATCCTCACCAGGCTCTTCCAGCAGCTGTCCCAGGTCTACGAGACCATCGACGTCGAGTTC
GTCGAGGGTCTCGCCCAGTTCCCCGAGCCGTACCAGGTCACGCGCAGCACCATCGAAAAGTTCATCATGAACGGC
AACAAGAAGGGCGACCTCGCCATCCGCATGGACCACGCCACCGGCGTCCTCAGCTTCGACAACGACGTCTTCTCC
TCGGCCAAGGCGGGGCAGACGGGCGGCTCCGCGGACTCCGAGACGGGCACCGTCCAGCGCCTCCAGAGCACCCCG
TCCGAGATTGTCCGGTCGCAGCTGACCCGCCTGGCCCGGTCCCTGTACACGACCTGCCACTACATCGACCCGAGC
TTCAACAAGGAGCGCCTCGCGGCCCGCAACGCGGCGCTGGCCCGCGCCAAGGCCGGCGCCGAGCAGGAACATCTC
GAGGTCTTGGCGCGCAAGGAGGTGATCCAGAAGCGCAAGGAAGAGGCCACCGAGATGCAGGCCAAGCGGGACAAG
GAGAACGCCCGACAGAAGCGGTTGCGCGAGCAGGCGCTGCAGGAGGCGGAGGACAAGCGGTTGGCGGCCGAGCAG
AAGGAGCGCGAGGCTAAGCGCCTCAAGGCGGAGCGGGATCGCGTCCGCAAGGAGGAGCTCAAGAAGCAGATCGCC
GACCTCAAGATGAGCGACAAGGCTCTCGACATTGACCTCGACGACCTCGACAACCTCGACGCGAACCGGCTCCGT
GCCATGAAGCTGGCCCAGCTGGAGCGGGAGAAGAACGACGTCAACGAGAGGCTGCGCATCACGGGCAAGCGCATA
GACCACTTGGAGCGAGCCTTCCGCAAGGAAGAAGGGAGGAAGCTCCACCAGGACTACGCGGAGCAGAACGAGCAG
GACCACGCCGTTTACGAGACGCTCAAGGCCAAGACGCTCAGGGAGGCCGAAGAGAAGCACAAGGAGAGCGTCGAG
CTCAAGCACCGGCTCAGCCGCCTGGTGCCCCTGTACGAAGGCTTCCGGCGCTCGCTCCACGAACGGCGGCGCGAC
GAGTTCGAGAAGCGGCGCAAGGACGCGGAGCGCGAGCTGGAGAAGCAGATTGCGGCCCGCAAGAAGGAGGTCCGG
GACCGCAAGATGAGGGAGAAGCGGGAACGGGAGGAAAAGGAGCGACAGCTTCGCGAGGCCGAAGAGCGGGCGGCG
CGCGAAAAGGAGGAGCAGCGGCTCCGCGACGAAGCCAGGAAGGCCGAGATGGCCAAGCTCAAGGAGCAGAGGGAG
AGGGAGCGGCAGGAGACGCTCGAGAAGGCGGCGCTGCAGCAGCGACGGGAGGAGGAGGCGCTGGCGCGTCGGAAG
GCGGAGAAGGAGAGGGCACCGCTGGCCTCGAGGCCGGACATGGGAGACTCGCGGAGGCCGGAGGCGGCGGCGGCG
GCGGCGGGCGGAGGAGGTTACTGGCGCGGATCAAGCAACGCGGAAGCACCGGTACGGGCCGCCGGCGACTCCAAG
GACCGGCCTTCGGGCCCGCCGAAGCTGCAGCTGGCGGGCGGCAAGCCGAGCTGGCGCGATCGCGAGGCGGCGAAG
GCGGCGGCGTCTGCGGCGGGCGGCGGCGGAGGGGGAGGAGGCGAGAACGGACCGGAAGCGGCGACGGGAGGCCGG
ACAGGCGGAGCGCGGCCGGCACGGGAGGAGGAGAACGGCGGACGGACGGCACCGGAGCCGCTGCCGGCGTCACGG
GGGGGCAAGTGGGTTCCCCCTCACAAGAGAAACCAGGCTCGGACCATCAGCTCCCTTGTCTCGGTTTCCGGTGGC
AGCCTCTGA
Transcript >Ophun1|7335
ATGCCTCCTCCGCCGCATCAAAAGCCGGAAAATGTCCTCAAGCGCGCTCATGAGCTCATTGGGGTTCATCAGGCT
CAGGCTGCCTTGACCTTGCTGCATGAGCACATCACCAGCAAGCGCTCTCGCAATGCCCCGATCGCCTCGTTGGAG
CCTGTTATGCTCCTGTTGGTCGAGTTGTCGGTTGAGCAGAAAAAGGGCAAGCTGGCCAAGGATGCTCTCTACCAG
TACAAGAACATTTCGCAGAATACAAACATTGCCACCATCGAGCTCGTCCTCAAAAAGTTCATCGAGTTGGCCGTT
GAAAAGGTCACCGCCGCCCAGCAAAAGGCCGATGAGGTTCAGTCCAGCATCGATGCCACCGCCGCCGCCACCTCG
AGCATCGATGACCTCGAGGCCAGCGAGACGCCAGAGTCCATCCTCCTCGCAACCGTTTCGGGAGAGCAGTCGCGC
GATCGCACCGACCGCGCCATCGTCACCCCTTGGCTCAAGTTCTTGTGGGAGGCCTACCGTACCGTCCTCGACATC
CTCCGCAACAATGCCCGCCTGGAGCTCCTCTACCAGAGCACCGCCATGCAGGCCTTTGACTTTTGCCTCAAGTAC
ACGAGGAAGACGGAGTTTCGAAGGCTCTGCGAGCTGCTCCGCAACCACGTCCAGACGGCCGCAAAGTACTCGTCT
CAGATGCACGCCATCAATCTGAGCGACCCGGACACCCTCCAGCGCCACCTCGAGACCCGCTTCCAGCAGCTCAAC
GTCGCCGTCGAGCTCGAGCTGTGGCAGGAGGCCTTCCGCAGCGTCGAGGACATCCACACCCTCCTCAATCTCAGC
AAGAGGCCTCCCAAGAACGTCATGATGGCCAACTACTACGAGAAGCTGACCCGCATCTTCCTCGTCGGCGAAAAC
TACCTCTTCCACGCCGCCGCCTGGTCCAGGTACTACTCGCTGCTGCGACAGTCTGCCGCTCTGGTCGCCGGCGGC
CAGGGCAAAAAGGCCGACAACCCGCCCGCCTCCGACGCCGACCTCCAAAAGGCGGCCTCCTTCGTCCTCCTGTCC
GCGCTGGCCATACCCGTCATCAGCACCACCCGGTCCCGCGGCGCCATGGTCGACTTCGACGAGGCCAAGAAGAAC
AAGAACTCGCGCCTCACGCACCTGCTGGGCATGAACCAGGCGCCCACCCGGGCCAGGCTCTTCCGCGACGCCCTG
TCCAAGTCTCTCCTGCAGCGCGTCCGCCCCGAGATCCGCGACCTGTACAACATGCTCGAAGTCGACTTCCACCCT
CTTTCCATCTGCCAAAAGATCTCGCCCATCCTGACCAAGATCGGTGCAGACGCCGAGATGGAGCGCTACATCGTG
CCCCTGCAGCAGGTCATCCTCACCAGGCTCTTCCAGCAGCTGTCCCAGGTCTACGAGACCATCGACGTCGAGTTC
GTCGAGGGTCTCGCCCAGTTCCCCGAGCCGTACCAGGTCACGCGCAGCACCATCGAAAAGTTCATCATGAACGGC
AACAAGAAGGGCGACCTCGCCATCCGCATGGACCACGCCACCGGCGTCCTCAGCTTCGACAACGACGTCTTCTCC
TCGGCCAAGGCGGGGCAGACGGGCGGCTCCGCGGACTCCGAGACGGGCACCGTCCAGCGCCTCCAGAGCACCCCG
TCCGAGATTGTCCGGTCGCAGCTGACCCGCCTGGCCCGGTCCCTGTACACGACCTGCCACTACATCGACCCGAGC
TTCAACAAGGAGCGCCTCGCGGCCCGCAACGCGGCGCTGGCCCGCGCCAAGGCCGGCGCCGAGCAGGAACATCTC
GAGGTCTTGGCGCGCAAGGAGGTGATCCAGAAGCGCAAGGAAGAGGCCACCGAGATGCAGGCCAAGCGGGACAAG
GAGAACGCCCGACAGAAGCGGTTGCGCGAGCAGGCGCTGCAGGAGGCGGAGGACAAGCGGTTGGCGGCCGAGCAG
AAGGAGCGCGAGGCTAAGCGCCTCAAGGCGGAGCGGGATCGCGTCCGCAAGGAGGAGCTCAAGAAGCAGATCGCC
GACCTCAAGATGAGCGACAAGGCTCTCGACATTGACCTCGACGACCTCGACAACCTCGACGCGAACCGGCTCCGT
GCCATGAAGCTGGCCCAGCTGGAGCGGGAGAAGAACGACGTCAACGAGAGGCTGCGCATCACGGGCAAGCGCATA
GACCACTTGGAGCGAGCCTTCCGCAAGGAAGAAGGGAGGAAGCTCCACCAGGACTACGCGGAGCAGAACGAGCAG
GACCACGCCGTTTACGAGACGCTCAAGGCCAAGACGCTCAGGGAGGCCGAAGAGAAGCACAAGGAGAGCGTCGAG
CTCAAGCACCGGCTCAGCCGCCTGGTGCCCCTGTACGAAGGCTTCCGGCGCTCGCTCCACGAACGGCGGCGCGAC
GAGTTCGAGAAGCGGCGCAAGGACGCGGAGCGCGAGCTGGAGAAGCAGATTGCGGCCCGCAAGAAGGAGGTCCGG
GACCGCAAGATGAGGGAGAAGCGGGAACGGGAGGAAAAGGAGCGACAGCTTCGCGAGGCCGAAGAGCGGGCGGCG
CGCGAAAAGGAGGAGCAGCGGCTCCGCGACGAAGCCAGGAAGGCCGAGATGGCCAAGCTCAAGGAGCAGAGGGAG
AGGGAGCGGCAGGAGACGCTCGAGAAGGCGGCGCTGCAGCAGCGACGGGAGGAGGAGGCGCTGGCGCGTCGGAAG
GCGGAGAAGGAGAGGGCACCGCTGGCCTCGAGGCCGGACATGGGAGACTCGCGGAGGCCGGAGGCGGCGGCGGCG
GCGGCGGGCGGAGGAGGTTACTGGCGCGGATCAAGCAACGCGGAAGCACCGGTACGGGCCGCCGGCGACTCCAAG
GACCGGCCTTCGGGCCCGCCGAAGCTGCAGCTGGCGGGCGGCAAGCCGAGCTGGCGCGATCGCGAGGCGGCGAAG
GCGGCGGCGTCTGCGGCGGGCGGCGGCGGAGGGGGAGGAGGCGAGAACGGACCGGAAGCGGCGACGGGAGGCCGG
ACAGGCGGAGCGCGGCCGGCACGGGAGGAGGAGAACGGCGGACGGACGGCACCGGAGCCGCTGCCGGCGTCACGG
GGGGGCAAGTGGGTTCCCCCTCACAAGAGAAACCAGGCTCGGACCATCAGCTCCCTTGTCTCGGTTTCCGGTGGC
AGCCTCTGA
Gene >Ophun1|7335
ATGGTGCGTTGATTCCTCGGAACCCTTCCCCCTCCCTTGGTTCCCTACTGACGGTCTCGACAGCCTCCTCCGCCG
CATCAAAAGCCGGAAAATGTCCTCAAGCGCGCTCATGAGCTCATTGGGGTTCATCAGGCTCAGGCTGCCTTGACC
TTGCTGCATGAGCACATCACCAGCAAGCGCTCTCGCAATGCCCCGATCGCCTCGTTGGAGCCTGTTATGCTCCTG
TTGGTCGAGTTGTCGGTTGAGCAGAAAAAGGGCAAGCTGGCCAAGGATGCTCTCTACCAGTACAAGAACATTTCG
CAGAATACAAACATTGCCACCATCGAGGTTCGTCAACTGCCTGCTCCCTCGCCCTGACACACCTAGCTAACCTTT
CCAATAGCTCGTCCTCAAAAAGTTCATCGAGTTGGCCGTTGAAAAGGTCACCGCCGCCCAGCAAAAGGCCGATGA
GGTTCAGTCCAGCATCGATGCCACCGCCGCCGCCACCTCGAGCATCGATGACCTCGAGGCCAGCGAGACGCCAGA
GTCCATCCTCCTCGCAACCGTTTCGGGAGAGCAGTCGCGCGATCGCACCGACCGCGCCATCGTCACCCCTTGGCT
CAAGTTCTTGTGGGAGGCCTACCGTACCGTCCTCGACATCCTCCGCAACAATGCCCGCCTGGAGCTCCTCTACCA
GAGCACCGCCATGCAGGCCTTTGACTTTTGCCTCAAGTACACGAGGAAGACGGAGTTTCGAAGGCTCTGCGAGCT
GCTCCGCAACCACGTCCAGACGGCCGCAAAGTACTCGTCTCAGATGCACGCCATCAATCTGAGCGACCCGGACAC
CCTCCAGCGCCACCTCGAGACCCGCTTCCAGCAGCTCAACGTCGCCGTCGAGCTCGAGCTGTGGCAGGAGGCCTT
CCGCAGCGTCGAGGACATCCACACCCTCCTCAATCTCAGCAAGAGGCCTCCCAAGAACGTCATGATGGCCAACTA
CTACGAGAAGCTGACCCGCATCTTCCTCGTCGGCGAAAACTACCTCTTCCACGCCGCCGCCTGGTCCAGGTACTA
CTCGCTGCTGCGACAGTCTGCCGCTCTGGTCGCCGGCGGCCAGGGCAAAAAGGCCGACAACCCGCCCGCCTCCGA
CGCCGACCTCCAAAAGGCGGCCTCCTTCGTCCTCCTGTCCGCGCTGGCCATACCCGTCATCAGCACCACCCGGTC
CCGCGGCGCCATGGTCGACTTCGACGAGGCCAAGAAGAACAAGAACTCGCGCCTCACGCACCTGCTGGGCATGAA
CCAGGCGCCCACCCGGGCCAGGCTCTTCCGCGACGCCCTGTCCAAGTCTCTCCTGCAGCGCGTCCGCCCCGAGAT
CCGCGACCTGTACAACATGCTCGAAGTCGACTTCCACCCTCTTTCCATCTGCCAAAAGATCTCGCCCATCCTGAC
CAAGATCGGTGCAGACGCCGAGATGGAGCGCTACATCGTGCCCCTGCAGCAGGTCATCCTCACCAGGCTCTTCCA
GCAGCTGTCCCAGGTCTACGAGACCATCGACGTCGAGTTCGTCGAGGGTCTCGCCCAGTTCCCCGAGCCGTACCA
GGTCACGCGCAGCACCATCGAAAAGTTCATCATGAACGGCAACAAGAAGGGCGACCTCGCCATCCGCATGGACCA
CGCCACCGGCGTCCTCAGCTTCGACAACGACGTCTTCTCCTCGGCCAAGGCGGGGCAGACGGGCGGCTCCGCGGA
CTCCGAGACGGGCACCGTCCAGCGCCTCCAGAGCACCCCGTCCGAGATTGTCCGGTCGCAGCTGACCCGCCTGGC
CCGGTCCCTGTACACGACCTGCCACTACATCGACCCGAGCTTCAACAAGGAGCGCCTCGCGGCCCGCAACGCGGC
GCTGGCCCGCGCCAAGGCCGGCGCCGAGCAGGAACATCTCGAGGTCTTGGCGCGCAAGGAGGTGATCCAGAAGCG
CAAGGAAGAGGCCACCGAGATGCAGGCCAAGCGGGACAAGGAGAACGCCCGACAGAAGCGGTTGCGCGAGCAGGC
GCTGCAGGAGGCGGAGGACAAGCGGTTGGCGGCCGAGCAGAAGGAGCGCGAGGCTAAGCGCCTCAAGGCGGAGCG
GGATCGCGTCCGCAAGGAGGAGCTCAAGAAGCAGATCGCCGACCTCAAGATGAGCGACAAGGCTCTCGACATTGA
CCTCGACGACCTCGACAACCTCGACGCGAACCGGCTCCGTGCCATGAAGCTGGCCCAGCTGGAGCGGGAGAAGAA
CGACGTCAACGAGAGGCTGCGCATCACGGGCAAGCGCATAGACCACTTGGAGCGAGCCTTCCGCAAGGAAGAAGG
GAGGAAGCTCCACCAGGACTACGCGGAGCAGAACGAGCAGGACCACGCCGTTTACGAGACGCTCAAGGCCAAGAC
GCTCAGGGAGGCCGAAGAGAAGCACAAGGAGAGCGTCGAGCTCAAGCACCGGCTCAGCCGCCTGGTGCCCCTGTA
CGAAGGCTTCCGGCGCTCGCTCCACGAACGGCGGCGCGACGAGTTCGAGAAGCGGCGCAAGGACGCGGAGCGCGA
GCTGGAGAAGCAGATTGCGGCCCGCAAGAAGGAGGTCCGGGACCGCAAGATGAGGGAGAAGCGGGAACGGGAGGA
AAAGGAGCGACAGCTTCGCGAGGCCGAAGAGCGGGCGGCGCGCGAAAAGGAGGAGCAGCGGCTCCGCGACGAAGC
CAGGAAGGCCGAGATGGCCAAGCTCAAGGAGCAGAGGGAGAGGGAGCGGCAGGAGACGCTCGAGAAGGCGGCGCT
GCAGCAGCGACGGGAGGAGGAGGCGCTGGCGCGTCGGAAGGCGGAGAAGGAGAGGGCACCGCTGGCCTCGAGGCC
GGACATGGGAGACTCGCGGAGGCCGGAGGCGGCGGCGGCGGCGGCGGGCGGAGGAGGTTACTGGCGCGGATCAAG
CAACGCGGAAGCACCGGTACGGGCCGCCGGCGACTCCAAGGACCGGCCTTCGGGCCCGCCGAAGCTGCAGCTGGC
GGGCGGCAAGCCGAGCTGGCGCGATCGCGAGGCGGCGAAGGCGGCGGCGTCTGCGGCGGGCGGCGGCGGAGGGGG
AGGAGGCGAGAACGGACCGGAAGCGGCGACGGGAGGCCGGACAGGCGGAGCGCGGCCGGCACGGGAGGAGGAGAA
CGGCGGACGGACGGCACCGGAGCCGCTGCCGGCGTCACGGGGGGGCAAGTGGGTTCCCCCTCACAAGAGAAACCA
GGCGTGAGACGATGGATGGCATGGGCGTTGGGCGAGAGAGCAGCTGTCTCGCTGTTCAGCAGGTGTGGCCTACCG
GTGATGTCTCTGAGTTTCCAGGCTGGTTATCGTTCTCTAAAGTTGTAATATACAGAGATGTCTCTGGGACAATGT
CTCTGGGACCGAATATGGCGGTTATCTCGGCTTTTGCTTGCGTGCTGACGGCATAGTCGGACCATCAGCTCCCTT
GTCTCGGTTTCCGGTGGCAGCCTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail