Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7334
Gene name
LocationContig_900:1156..5340
Strand-
Gene length (bp)4184
Transcript length (bp)3912
Coding sequence length (bp)3912
Protein length (aa) 1304

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02373 JmjC JmjC domain, hydroxylase 8.9E-09 205 323
PF10497 zf-4CXXC_R1 Zinc-finger domain of monoamine-oxidase A repressor R1 4.2E-06 513 583

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1711
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|392
Ophiocordyceps australis map64 (Brazil) OphauB2|8157
Ophiocordyceps camponoti-floridani Ophcf2|05629
Ophiocordyceps camponoti-rufipedis Ophun1|7334 (this protein)
Ophiocordyceps kimflemingae Ophio5|8566
Ophiocordyceps subramaniannii Hirsu2|1519

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7334
MPTSLHPQAKFDPIPPDIDLQALVDKTPNFRWVQRVSREQIRNLGPQEFEKLVQIHVIGSGKPLVIDGWDAVLPK
WLFNVDWLESTYDKKRENVRDIPAATDIPMTTGHYLRSMRQLANQWTPHTFRDDRRQRLYLKDIDCPPEWREALQ
KIIHPGLFYLNENVSVSSTSARLQKEDSFLSEATGAPAGDLMSSLPETMRAENLMCYIGHEGTYTPAHREMCASL
GQNIMVETSDDSNGDKAGSSIWFMTESKDREVVREYFLSMLGHDIEIEKHFAQINAWKKAPFDVYIVEQRAGDFI
LIPPLAAHQVWNRGTRTMKVAWNRTTVDSLDLALHEALPKARLVCRDEQYKNKAIVYFTLEKYFGQLQQLEKNAE
STRMSLMGIGHDIVRKSTRVRQLAGDFKRLFSLFTEILVDEAFAYKEKDVDLLPFDSCITSNDGCIDIDASPQPF
EVARLKSGKKSVAQICQEALRRRPWKDITKHEEQVKSPSESEPGEGDDKVRKKSKRKKKKGEVRRCHVCCHKDYS
YRVHECCNPECTEAYCYGVLYRAFDLMPQKVLEDEYWQCPKCLGICSCGSCRRSGNTNAYTPKNTLLGHDTRPIA
DDRSVEALVDFRVHNLSWLKAVGEESRSKDSRRMQRLREQADNAKAQDQTHQVEAEQAMHDENGAAGVSSSKSDE
MQHAIDGDDRSEFIQQRCLPAGDNHEATSAGLADHDPKPMFDTGSSPDIAVDATNTLSYPDPSVFIRQRIGMGYY
EQDDTPDKILFDPYQVPSVDAVGLSEAGVPEFVKKSIRAAKRKARRENEDPDFVVGRGQSKRPRFFQPHSINNSM
DPALLEDSGMHRTDRDQHEGDGASQARQLSEQVKDSSKPRAPKRAALPRFDANEPTLRHAKPLTSYVELEDVDLD
ELEEDDLGDRVQSPVGNSAPTQPAVAMDLGANDTTAMPESLYSGGENPVSQTTSERPVQKRRGRPPKQKFAAAAP
TRSTPVSVTKAVTAEKIPGKRGRGRPRKSTNTTTATDGDAFATRNEPGTETVVENIRDSQATSKFTRSSRNRPTP
GDAPRRTRLRGVTTITAATANEEASPPGDSGLDPLSNPDQSLQEKLVPPGTPVKPIRGGGRLRRSDVPQSASPAC
DEDELASQTFMSLAERMALRGKKFKIGRRKLRNVSSMPENVTSSKDGDDSSRSLERGPSPDEGMDENRIDLSPSP
SATDAAKKSSPGAGSNIRTRGARLAVEHRGSSNRQPTVVRLADVGSEEESGWQVSSSSTDDEDIPSRRPNLGGTP
RGRGSLRGRRGSRARTRARGLRMVSRRY*
Coding >Ophun1|7334
ATGCCGACCTCTCTTCATCCGCAAGCCAAGTTCGATCCCATTCCGCCTGATATCGATCTTCAAGCCTTGGTTGAT
AAAACGCCGAACTTCAGATGGGTTCAGCGCGTATCTAGGGAGCAGATTCGCAACTTGGGTCCCCAAGAGTTTGAA
AAGCTCGTCCAAATACATGTTATTGGAAGCGGGAAGCCTCTGGTCATTGATGGATGGGACGCGGTGCTTCCCAAG
TGGCTTTTCAATGTTGACTGGCTGGAGAGCACGTATGACAAGAAGCGCGAGAATGTCCGAGATATACCGGCCGCG
ACAGATATCCCAATGACTACAGGTCACTACCTCCGATCCATGAGACAGTTGGCGAACCAATGGACGCCGCACACC
TTTCGAGATGATCGTCGACAACGACTATACCTCAAAGACATCGACTGCCCACCGGAATGGCGCGAAGCGCTGCAG
AAGATCATCCATCCTGGCTTGTTCTACTTGAACGAGAACGTCAGCGTTTCCAGCACCAGTGCTCGTCTCCAAAAA
GAGGACAGTTTCCTCAGCGAGGCCACGGGCGCCCCAGCAGGAGACCTCATGTCCAGCCTCCCGGAGACCATGCGC
GCCGAGAACCTCATGTGCTACATCGGCCATGAAGGCACATATACACCTGCGCACCGGGAGATGTGTGCATCACTG
GGCCAAAATATCATGGTCGAGACTTCCGACGATAGCAATGGTGATAAGGCTGGCAGCTCCATCTGGTTCATGACC
GAGAGTAAAGATCGTGAAGTCGTCCGAGAATATTTCCTATCGATGCTGGGTCACGACATCGAGATCGAGAAACAT
TTCGCACAAATAAATGCCTGGAAAAAGGCACCATTCGATGTTTACATTGTTGAACAACGTGCTGGAGACTTCATT
CTCATCCCTCCCTTGGCTGCTCACCAAGTCTGGAATAGGGGCACTCGGACCATGAAGGTAGCATGGAATCGGACG
ACCGTGGACTCGCTAGATCTGGCCTTGCACGAGGCCCTTCCAAAGGCGAGACTTGTTTGCCGGGACGAACAGTAT
AAGAACAAAGCCATCGTCTACTTCACTCTCGAGAAGTATTTTGGTCAGCTGCAGCAATTGGAGAAAAACGCTGAG
TCGACGCGAATGAGTCTGATGGGAATCGGCCACGATATCGTTCGGAAGTCTACGCGCGTAAGGCAGTTGGCCGGC
GACTTCAAGCGACTTTTTAGCCTCTTCACCGAAATACTCGTTGATGAGGCATTTGCTTACAAGGAAAAGGATGTC
GATCTTCTACCGTTTGACTCCTGCATCACATCTAACGATGGCTGCATCGACATTGACGCCTCTCCACAGCCTTTT
GAGGTCGCTCGTCTCAAGTCAGGGAAGAAGTCAGTGGCACAGATATGCCAAGAGGCCTTGAGAAGAAGACCCTGG
AAAGACATCACAAAACATGAAGAACAGGTCAAGTCTCCGAGCGAGTCTGAGCCTGGAGAAGGCGACGACAAGGTC
CGAAAGAAGTCAAAACGAAAGAAGAAGAAGGGCGAGGTTCGCAGATGCCACGTCTGTTGTCATAAAGATTACAGC
TACCGTGTTCATGAATGCTGTAACCCTGAATGCACTGAAGCTTACTGCTACGGCGTCCTCTATCGTGCTTTCGAC
CTGATGCCACAGAAGGTTTTGGAAGACGAATATTGGCAGTGTCCTAAATGCCTCGGGATTTGCAGTTGCGGCAGT
TGTCGTCGATCCGGCAACACCAATGCCTACACCCCGAAGAACACATTATTAGGACACGACACGCGTCCCATTGCG
GACGATCGGAGCGTGGAGGCCCTCGTCGATTTCCGGGTGCACAATCTCTCTTGGCTCAAGGCGGTAGGAGAGGAG
AGCCGGAGCAAAGACAGCCGACGCATGCAGCGGCTGCGTGAACAAGCCGATAACGCCAAGGCTCAGGATCAAACC
CATCAAGTTGAGGCGGAGCAAGCGATGCATGATGAAAATGGAGCCGCTGGCGTGTCCTCGTCGAAAAGTGATGAG
ATGCAGCACGCCATCGACGGCGACGATCGAAGCGAGTTTATCCAGCAGCGCTGCTTGCCAGCAGGCGACAACCAT
GAAGCAACGAGTGCTGGCCTCGCCGATCACGACCCAAAGCCCATGTTCGATACTGGGAGTTCTCCTGATATCGCT
GTCGATGCAACCAACACCCTCTCATATCCAGATCCCTCCGTTTTCATCCGCCAGAGGATTGGCATGGGATATTAC
GAGCAGGATGATACCCCCGATAAGATATTATTCGACCCTTACCAAGTGCCTTCGGTGGATGCGGTCGGTTTGTCT
GAGGCCGGAGTTCCCGAGTTTGTGAAGAAATCGATTCGTGCAGCGAAGAGAAAGGCCAGGCGGGAGAACGAGGAT
CCTGACTTCGTTGTTGGAAGAGGTCAATCCAAGAGGCCTCGCTTTTTTCAACCACACAGCATCAACAACAGTATG
GATCCAGCTCTTCTCGAGGATAGCGGCATGCACAGGACGGATCGTGATCAGCATGAAGGAGATGGTGCTTCTCAG
GCACGTCAGCTGTCAGAACAGGTGAAAGACAGTTCAAAACCACGGGCTCCGAAGCGAGCGGCATTACCACGATTC
GACGCCAACGAACCCACCTTGAGACATGCAAAACCGTTGACGTCATACGTAGAGCTGGAAGACGTGGACCTTGAT
GAACTTGAAGAGGATGACTTGGGCGATCGAGTCCAGTCACCCGTCGGAAATTCTGCTCCGACACAGCCTGCAGTG
GCTATGGATCTGGGGGCTAATGACACCACTGCGATGCCAGAGTCCCTTTATTCTGGTGGGGAAAATCCAGTTTCT
CAAACAACAAGCGAGCGTCCCGTCCAGAAGCGAAGAGGCCGACCTCCCAAGCAAAAGTTTGCGGCAGCTGCACCC
ACCAGATCAACACCTGTGAGTGTCACCAAAGCAGTAACCGCTGAGAAGATACCTGGCAAAAGAGGCAGGGGAAGG
CCCAGGAAGTCTACGAATACGACTACCGCCACTGACGGCGATGCATTCGCAACCCGGAACGAGCCAGGGACAGAA
ACGGTTGTTGAGAATATACGAGATTCGCAGGCCACAAGCAAGTTCACCAGATCATCAAGAAACCGCCCGACCCCA
GGTGATGCTCCGCGACGAACCAGGCTCCGTGGTGTCACGACTATAACGGCGGCCACAGCCAACGAAGAGGCATCT
CCTCCCGGCGACAGTGGGCTTGATCCGTTATCAAACCCAGATCAATCGCTGCAAGAGAAATTGGTTCCTCCTGGT
ACCCCAGTGAAGCCCATCAGGGGAGGGGGGCGCCTCAGACGATCTGACGTTCCCCAGAGTGCTTCGCCCGCATGC
GACGAGGATGAGCTCGCCAGTCAAACATTCATGTCCTTGGCTGAACGTATGGCGCTGCGAGGCAAAAAATTCAAG
ATTGGAAGACGAAAACTCAGAAATGTTTCTTCGATGCCGGAAAACGTGACGTCCTCCAAGGATGGTGATGATAGC
TCCCGATCCTTGGAACGCGGACCGTCGCCAGATGAGGGAATGGACGAGAACAGAATTGATCTTTCACCCTCTCCA
TCAGCGACAGACGCGGCTAAGAAGTCTTCACCTGGCGCTGGTTCAAACATCCGAACCCGCGGGGCCAGGCTTGCA
GTTGAGCACCGCGGTAGCTCGAATCGACAGCCTACAGTCGTGAGGCTTGCAGATGTAGGGTCTGAAGAGGAGTCG
GGATGGCAGGTTTCGTCAAGTTCGACGGATGATGAGGATATTCCGTCTAGACGACCGAATTTGGGAGGAACCCCG
CGAGGCCGAGGAAGCTTAAGGGGTAGAAGGGGGTCTCGGGCGCGCACCCGGGCGCGGGGACTACGGATGGTTTCG
AGAAGGTATTAA
Transcript >Ophun1|7334
ATGCCGACCTCTCTTCATCCGCAAGCCAAGTTCGATCCCATTCCGCCTGATATCGATCTTCAAGCCTTGGTTGAT
AAAACGCCGAACTTCAGATGGGTTCAGCGCGTATCTAGGGAGCAGATTCGCAACTTGGGTCCCCAAGAGTTTGAA
AAGCTCGTCCAAATACATGTTATTGGAAGCGGGAAGCCTCTGGTCATTGATGGATGGGACGCGGTGCTTCCCAAG
TGGCTTTTCAATGTTGACTGGCTGGAGAGCACGTATGACAAGAAGCGCGAGAATGTCCGAGATATACCGGCCGCG
ACAGATATCCCAATGACTACAGGTCACTACCTCCGATCCATGAGACAGTTGGCGAACCAATGGACGCCGCACACC
TTTCGAGATGATCGTCGACAACGACTATACCTCAAAGACATCGACTGCCCACCGGAATGGCGCGAAGCGCTGCAG
AAGATCATCCATCCTGGCTTGTTCTACTTGAACGAGAACGTCAGCGTTTCCAGCACCAGTGCTCGTCTCCAAAAA
GAGGACAGTTTCCTCAGCGAGGCCACGGGCGCCCCAGCAGGAGACCTCATGTCCAGCCTCCCGGAGACCATGCGC
GCCGAGAACCTCATGTGCTACATCGGCCATGAAGGCACATATACACCTGCGCACCGGGAGATGTGTGCATCACTG
GGCCAAAATATCATGGTCGAGACTTCCGACGATAGCAATGGTGATAAGGCTGGCAGCTCCATCTGGTTCATGACC
GAGAGTAAAGATCGTGAAGTCGTCCGAGAATATTTCCTATCGATGCTGGGTCACGACATCGAGATCGAGAAACAT
TTCGCACAAATAAATGCCTGGAAAAAGGCACCATTCGATGTTTACATTGTTGAACAACGTGCTGGAGACTTCATT
CTCATCCCTCCCTTGGCTGCTCACCAAGTCTGGAATAGGGGCACTCGGACCATGAAGGTAGCATGGAATCGGACG
ACCGTGGACTCGCTAGATCTGGCCTTGCACGAGGCCCTTCCAAAGGCGAGACTTGTTTGCCGGGACGAACAGTAT
AAGAACAAAGCCATCGTCTACTTCACTCTCGAGAAGTATTTTGGTCAGCTGCAGCAATTGGAGAAAAACGCTGAG
TCGACGCGAATGAGTCTGATGGGAATCGGCCACGATATCGTTCGGAAGTCTACGCGCGTAAGGCAGTTGGCCGGC
GACTTCAAGCGACTTTTTAGCCTCTTCACCGAAATACTCGTTGATGAGGCATTTGCTTACAAGGAAAAGGATGTC
GATCTTCTACCGTTTGACTCCTGCATCACATCTAACGATGGCTGCATCGACATTGACGCCTCTCCACAGCCTTTT
GAGGTCGCTCGTCTCAAGTCAGGGAAGAAGTCAGTGGCACAGATATGCCAAGAGGCCTTGAGAAGAAGACCCTGG
AAAGACATCACAAAACATGAAGAACAGGTCAAGTCTCCGAGCGAGTCTGAGCCTGGAGAAGGCGACGACAAGGTC
CGAAAGAAGTCAAAACGAAAGAAGAAGAAGGGCGAGGTTCGCAGATGCCACGTCTGTTGTCATAAAGATTACAGC
TACCGTGTTCATGAATGCTGTAACCCTGAATGCACTGAAGCTTACTGCTACGGCGTCCTCTATCGTGCTTTCGAC
CTGATGCCACAGAAGGTTTTGGAAGACGAATATTGGCAGTGTCCTAAATGCCTCGGGATTTGCAGTTGCGGCAGT
TGTCGTCGATCCGGCAACACCAATGCCTACACCCCGAAGAACACATTATTAGGACACGACACGCGTCCCATTGCG
GACGATCGGAGCGTGGAGGCCCTCGTCGATTTCCGGGTGCACAATCTCTCTTGGCTCAAGGCGGTAGGAGAGGAG
AGCCGGAGCAAAGACAGCCGACGCATGCAGCGGCTGCGTGAACAAGCCGATAACGCCAAGGCTCAGGATCAAACC
CATCAAGTTGAGGCGGAGCAAGCGATGCATGATGAAAATGGAGCCGCTGGCGTGTCCTCGTCGAAAAGTGATGAG
ATGCAGCACGCCATCGACGGCGACGATCGAAGCGAGTTTATCCAGCAGCGCTGCTTGCCAGCAGGCGACAACCAT
GAAGCAACGAGTGCTGGCCTCGCCGATCACGACCCAAAGCCCATGTTCGATACTGGGAGTTCTCCTGATATCGCT
GTCGATGCAACCAACACCCTCTCATATCCAGATCCCTCCGTTTTCATCCGCCAGAGGATTGGCATGGGATATTAC
GAGCAGGATGATACCCCCGATAAGATATTATTCGACCCTTACCAAGTGCCTTCGGTGGATGCGGTCGGTTTGTCT
GAGGCCGGAGTTCCCGAGTTTGTGAAGAAATCGATTCGTGCAGCGAAGAGAAAGGCCAGGCGGGAGAACGAGGAT
CCTGACTTCGTTGTTGGAAGAGGTCAATCCAAGAGGCCTCGCTTTTTTCAACCACACAGCATCAACAACAGTATG
GATCCAGCTCTTCTCGAGGATAGCGGCATGCACAGGACGGATCGTGATCAGCATGAAGGAGATGGTGCTTCTCAG
GCACGTCAGCTGTCAGAACAGGTGAAAGACAGTTCAAAACCACGGGCTCCGAAGCGAGCGGCATTACCACGATTC
GACGCCAACGAACCCACCTTGAGACATGCAAAACCGTTGACGTCATACGTAGAGCTGGAAGACGTGGACCTTGAT
GAACTTGAAGAGGATGACTTGGGCGATCGAGTCCAGTCACCCGTCGGAAATTCTGCTCCGACACAGCCTGCAGTG
GCTATGGATCTGGGGGCTAATGACACCACTGCGATGCCAGAGTCCCTTTATTCTGGTGGGGAAAATCCAGTTTCT
CAAACAACAAGCGAGCGTCCCGTCCAGAAGCGAAGAGGCCGACCTCCCAAGCAAAAGTTTGCGGCAGCTGCACCC
ACCAGATCAACACCTGTGAGTGTCACCAAAGCAGTAACCGCTGAGAAGATACCTGGCAAAAGAGGCAGGGGAAGG
CCCAGGAAGTCTACGAATACGACTACCGCCACTGACGGCGATGCATTCGCAACCCGGAACGAGCCAGGGACAGAA
ACGGTTGTTGAGAATATACGAGATTCGCAGGCCACAAGCAAGTTCACCAGATCATCAAGAAACCGCCCGACCCCA
GGTGATGCTCCGCGACGAACCAGGCTCCGTGGTGTCACGACTATAACGGCGGCCACAGCCAACGAAGAGGCATCT
CCTCCCGGCGACAGTGGGCTTGATCCGTTATCAAACCCAGATCAATCGCTGCAAGAGAAATTGGTTCCTCCTGGT
ACCCCAGTGAAGCCCATCAGGGGAGGGGGGCGCCTCAGACGATCTGACGTTCCCCAGAGTGCTTCGCCCGCATGC
GACGAGGATGAGCTCGCCAGTCAAACATTCATGTCCTTGGCTGAACGTATGGCGCTGCGAGGCAAAAAATTCAAG
ATTGGAAGACGAAAACTCAGAAATGTTTCTTCGATGCCGGAAAACGTGACGTCCTCCAAGGATGGTGATGATAGC
TCCCGATCCTTGGAACGCGGACCGTCGCCAGATGAGGGAATGGACGAGAACAGAATTGATCTTTCACCCTCTCCA
TCAGCGACAGACGCGGCTAAGAAGTCTTCACCTGGCGCTGGTTCAAACATCCGAACCCGCGGGGCCAGGCTTGCA
GTTGAGCACCGCGGTAGCTCGAATCGACAGCCTACAGTCGTGAGGCTTGCAGATGTAGGGTCTGAAGAGGAGTCG
GGATGGCAGGTTTCGTCAAGTTCGACGGATGATGAGGATATTCCGTCTAGACGACCGAATTTGGGAGGAACCCCG
CGAGGCCGAGGAAGCTTAAGGGGTAGAAGGGGGTCTCGGGCGCGCACCCGGGCGCGGGGACTACGGATGGTTTCG
AGAAGGTATTAA
Gene >Ophun1|7334
ATGCCGACCTCTCTTCATCCGCAAGCCAAGTTCGATCCCATTCCGCCTGATATCGATCTTCAAGCCTTGGTTGAT
AAAACGCCGAACTTCAGATGGGTTCAGCGCGTATCTAGGGAGCAGATTCGCAACTTGGGTCCCCAAGAGTTTGAA
AAGCTCGTCCAAATACATGTTATTGGAAGCGGGAAGCCTCTGGTCATTGATGGATGGGACGCGGTGCTTCCCAAG
TGGCTTTTCAATGTTGACTGGCTGGAGAGCACGTATGACAAGAAGCGTCAGTGTCCAACGGTGTGGTTTCCCACC
GGTATTTGACACTGACATTACGAGCAGGCGAGAATGTCCGAGATATACCGGCCGCGACAGATATCCCAATGACTA
CAGGTCACTACCTCCGATCCATGAGACAGTTGGCGAACCAATGGACGCCGCACACCTTTCGAGATGATCGTCGAC
AACGACTATACCTCAAAGACATCGACTGCCCACCGGAATGGCGCGAAGCGCTGCAGAAGATCATCCATCCTGGCT
TGTTCTACTTGAACGAGAACGTCAGCGTTTCCAGCACCAGTGCTCGTCTCCAAAAAGAGGACAGTTTCCTCAGCG
AGGCCACGGGCGCCCCAGCAGGAGACCTCATGTCCAGCCTCCCGGAGACCATGCGCGCCGAGAACCTCATGTGCT
ACATCGGCCATGAAGGCACATATACACCTGCGCACCGGGAGATGTGTGCATCACTGGGCCAAAATATCATGGTCG
AGACTTCCGACGATAGCAATGGTGATAAGGCTGGCAGCTCCATCTGGTTCATGACCGAGAGTAAAGATCGTGAAG
TCGTCCGAGAATATTTCCTATCGATGCTGGGTCACGACATCGAGATCGAGAAACATTTCGCACAAATAAATGCCT
GGAAAAAGGCACCATTCGATGTTTACATTGTTGAACAACGTGCTGGAGACTTCATTCTCATCCCTCCCTTGGCTG
CTCACCAAGTCTGGAATAGGGGCACTCGGACCATGAAGGTAGCATGGAATCGGACGACCGTGGACTCGCTAGATC
TGGCCTTGCACGAGGCCCTTCCAAAGGCGAGACTTGTTTGCCGGGACGAACAGTATAAGAACAAAGCCATCGTCT
ACTTCACTCTCGAGAAGTATTTTGGTCAGCTGCAGCAATTGGAGAAAAACGCTGAGTCGACGCGAATGAGTCTGA
TGGGAATCGGCCACGATATCGTTCGGAAGTCTACGCGCGTAAGGCAGTTGGCCGGCGACTTCAAGCGACTTTTTA
GCCTCTTCACCGAAATACTCGTTGATGAGGCATTTGCTTACAAGGAAAAGGATGTCGATCTTCTACCGTTTGACT
CCTGCATCACATGTTCTTACTGCCGGTCGAATATATTCAACAGATTTCTGACTTGCAAAAATTGCGTACGACCGC
TCATGAACGGGGATGAAGACGCTTACGACGTGTGCATGGAGTGTTATGCCATGGGACGATCATGTGCATGCATTT
CCGGGCTTCAATGGTGTGAGCAGTGGTCATGGCCGGGCCTTGTGGACAGATTCGAAACCTGGCGTGCCATGGTGA
TAGCTAACGATGGCTGCATCGACATTGACGCCTCTCCACAGCCTTTTGAGGTCGCTCGTCTCAAGTCAGGGAAGA
AGTCAGTGGCACAGATATGCCAAGAGGCCTTGAGAAGAAGACCCTGGAAAGACATCACAAAACATGAAGAACAGG
TCAAGTCTCCGAGCGAGTCTGAGCCTGGAGAAGGCGACGACAAGGTCCGAAAGAAGTCAAAACGAAAGAAGAAGA
AGGGCGAGGTTCGCAGATGCCACGTCTGTTGTCATAAAGATTACAGCTACCGTGTTCATGAATGCTGTAACCCTG
AATGCACTGAAGCTTACTGCTACGGCGTCCTCTATCGTGCTTTCGACCTGATGCCACAGAAGGTTTTGGAAGACG
AATATTGGCAGTGTCCTAAATGCCTCGGGATTTGCAGTTGCGGCAGTTGTCGTCGATCCGGCAACACCAATGCCT
ACACCCCGAAGAACACATTATTAGGACACGACACGCGTCCCATTGCGGACGATCGGAGCGTGGAGGCCCTCGTCG
ATTTCCGGGTGCACAATCTCTCTTGGCTCAAGGCGGTAGGAGAGGAGAGCCGGAGCAAAGACAGCCGACGCATGC
AGCGGCTGCGTGAACAAGCCGATAACGCCAAGGCTCAGGATCAAACCCATCAAGTTGAGGCGGAGCAAGCGATGC
ATGATGAAAATGGAGCCGCTGGCGTGTCCTCGTCGAAAAGTGATGAGATGCAGCACGCCATCGACGGCGACGATC
GAAGCGAGTTTATCCAGCAGCGCTGCTTGCCAGCAGGCGACAACCATGAAGCAACGAGTGCTGGCCTCGCCGATC
ACGACCCAAAGCCCATGTTCGATACTGGGAGTTCTCCTGATATCGCTGTCGATGCAACCAACACCCTCTCATATC
CAGATCCCTCCGTTTTCATCCGCCAGAGGATTGGCATGGGATATTACGAGCAGGATGATACCCCCGATAAGATAT
TATTCGACCCTTACCAAGTGCCTTCGGTGGATGCGGTCGGTTTGTCTGAGGCCGGAGTTCCCGAGTTTGTGAAGA
AATCGATTCGTGCAGCGAAGAGAAAGGCCAGGCGGGAGAACGAGGATCCTGACTTCGTTGTTGGAAGAGGTCAAT
CCAAGAGGCCTCGCTTTTTTCAACCACACAGCATCAACAACAGTATGGATCCAGCTCTTCTCGAGGATAGCGGCA
TGCACAGGACGGATCGTGATCAGCATGAAGGAGATGGTGCTTCTCAGGCACGTCAGCTGTCAGAACAGGTGAAAG
ACAGTTCAAAACCACGGGCTCCGAAGCGAGCGGCATTACCACGATTCGACGCCAACGAACCCACCTTGAGACATG
CAAAACCGTTGACGTCATACGTAGAGCTGGAAGACGTGGACCTTGATGAACTTGAAGAGGATGACTTGGGCGATC
GAGTCCAGTCACCCGTCGGAAATTCTGCTCCGACACAGCCTGCAGTGGCTATGGATCTGGGGGCTAATGACACCA
CTGCGATGCCAGAGTCCCTTTATTCTGGTGGGGAAAATCCAGTTTCTCAAACAACAAGCGAGCGTCCCGTCCAGA
AGCGAAGAGGCCGACCTCCCAAGCAAAAGTTTGCGGCAGCTGCACCCACCAGATCAACACCTGTGAGTGTCACCA
AAGCAGTAACCGCTGAGAAGATACCTGGCAAAAGAGGCAGGGGAAGGCCCAGGAAGTCTACGAATACGACTACCG
CCACTGACGGCGATGCATTCGCAACCCGGAACGAGCCAGGGACAGAAACGGTTGTTGAGAATATACGAGATTCGC
AGGCCACAAGCAAGTTCACCAGATCATCAAGAAACCGCCCGACCCCAGGTGATGCTCCGCGACGAACCAGGCTCC
GTGGTGTCACGACTATAACGGCGGCCACAGCCAACGAAGAGGCATCTCCTCCCGGCGACAGTGGGCTTGATCCGT
TATCAAACCCAGATCAATCGCTGCAAGAGAAATTGGTTCCTCCTGGTACCCCAGTGAAGCCCATCAGGGGAGGGG
GGCGCCTCAGACGATCTGACGTTCCCCAGAGTGCTTCGCCCGCATGCGACGAGGATGAGCTCGCCAGTCAAACAT
TCATGTCCTTGGCTGAACGTATGGCGCTGCGAGGCAAAAAATTCAAGATTGGAAGACGAAAACTCAGAAATGTTT
CTTCGATGCCGGAAAACGTGACGTCCTCCAAGGATGGTGATGATAGCTCCCGATCCTTGGAACGCGGACCGTCGC
CAGATGAGGGAATGGACGAGAACAGAATTGATCTTTCACCCTCTCCATCAGCGACAGACGCGGCTAAGAAGTCTT
CACCTGGCGCTGGTTCAAACATCCGAACCCGCGGGGCCAGGCTTGCAGTTGAGCACCGCGGTAGCTCGAATCGAC
AGCCTACAGTCGTGAGGCTTGCAGATGTAGGGTCTGAAGAGGAGTCGGGATGGCAGGTTTCGTCAAGTTCGACGG
ATGATGAGGATATTCCGTCTAGACGACCGAATTTGGGAGGAACCCCGCGAGGCCGAGGAAGCTTAAGGGGTAGAA
GGGGGTCTCGGGCGCGCACCCGGGCGCGGGGACTACGGATGGTTTCGAGAAGGTATTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail