Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7329
Gene name
LocationContig_90:32749..33586
Strand-
Gene length (bp)837
Transcript length (bp)669
Coding sequence length (bp)669
Protein length (aa) 223

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05141 DIT1_PvcA Pyoverdine/dityrosine biosynthesis protein 2.7E-22 5 79

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup899
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2529
Ophiocordyceps australis 1348a (Ghana) OphauG2|2557
Ophiocordyceps australis 1348a (Ghana) OphauG2|3148
Ophiocordyceps australis map64 (Brazil) OphauB2|1785
Ophiocordyceps australis map64 (Brazil) OphauB2|985
Ophiocordyceps australis map64 (Brazil) OphauB2|986
Ophiocordyceps camponoti-rufipedis Ophun1|7329 (this protein)
Ophiocordyceps subramaniannii Hirsu2|5853

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7329
MPAVHLNGMAAAIRDVYDPGARVSIVSDGLIYNDILGVDDEQVWEYREALRQLARENNLDNLEFLRQHHLFNAES
TSKEEYLRNALGPPERSNADPMAFGPRSSFVERDRPSYFREKFDLFNWPGLNLRFKYLCPTGILISARDHDQSYS
FQDVPILKIRRLAKDLQDKFAFNKISIGNRPQWYIRLLTDMLYDRRVTLWFAWSVGDVIVSDNLTTLQSYCV*
Coding >Ophun1|7329
ATGCCGGCGGTGCATCTCAATGGCATGGCCGCTGCTATCCGGGATGTCTACGACCCTGGAGCGAGAGTCTCGATT
GTATCCGACGGCTTGATATACAACGATATTCTCGGCGTTGACGACGAGCAAGTCTGGGAGTATAGGGAGGCTCTT
CGACAGCTTGCTAGGGAGAACAACCTCGACAACTTGGAGTTTCTGCGTCAGCATCATCTATTCAATGCCGAATCA
ACTTCCAAGGAGGAGTATCTGCGCAACGCCCTTGGTCCCCCAGAGCGGTCGAATGCTGACCCCATGGCATTCGGT
CCTCGTTCGAGCTTTGTTGAACGTGACCGGCCCTCCTATTTCCGCGAGAAGTTCGACTTGTTCAACTGGCCCGGT
CTCAATCTCCGCTTCAAGTATCTCTGCCCAACAGGCATCTTAATCTCGGCCCGAGATCATGACCAGTCATACTCT
TTCCAAGACGTCCCAATACTCAAGATTCGAAGACTCGCTAAGGACTTGCAAGACAAGTTTGCCTTTAACAAAATC
TCTATCGGGAACAGGCCTCAGTGGTATATCCGCCTTCTCACCGACATGCTGTACGACCGTCGGGTAACGCTCTGG
TTTGCATGGTCCGTCGGCGATGTCATCGTGTCAGACAACCTTACGACGCTACAGTCGTACTGCGTTTGA
Transcript >Ophun1|7329
ATGCCGGCGGTGCATCTCAATGGCATGGCCGCTGCTATCCGGGATGTCTACGACCCTGGAGCGAGAGTCTCGATT
GTATCCGACGGCTTGATATACAACGATATTCTCGGCGTTGACGACGAGCAAGTCTGGGAGTATAGGGAGGCTCTT
CGACAGCTTGCTAGGGAGAACAACCTCGACAACTTGGAGTTTCTGCGTCAGCATCATCTATTCAATGCCGAATCA
ACTTCCAAGGAGGAGTATCTGCGCAACGCCCTTGGTCCCCCAGAGCGGTCGAATGCTGACCCCATGGCATTCGGT
CCTCGTTCGAGCTTTGTTGAACGTGACCGGCCCTCCTATTTCCGCGAGAAGTTCGACTTGTTCAACTGGCCCGGT
CTCAATCTCCGCTTCAAGTATCTCTGCCCAACAGGCATCTTAATCTCGGCCCGAGATCATGACCAGTCATACTCT
TTCCAAGACGTCCCAATACTCAAGATTCGAAGACTCGCTAAGGACTTGCAAGACAAGTTTGCCTTTAACAAAATC
TCTATCGGGAACAGGCCTCAGTGGTATATCCGCCTTCTCACCGACATGCTGTACGACCGTCGGGTAACGCTCTGG
TTTGCATGGTCCGTCGGCGATGTCATCGTGTCAGACAACCTTACGACGCTACAGTCGTACTGCGTTTGA
Gene >Ophun1|7329
ATGCCGGCGGTGCATCTCAATGGCATGGCCGCTGCTATCCGGGATGTCTACGACCCTGGAGCGAGAGTCTCGATT
GTATCCGACGGCTTGATATACAACGATATTCTCGGCGTTGACGACGAGCAAGTCTGGGAGTATAGGGAGGCTCTT
CGACAGCTTGCTAGGGAGAACAACCTCGACAACTTGGAGTTTCTGCGTCAGCATCATCTATTCAATGCCGAATCA
ACTTCCAAGGAGGAGTATCTGCGCAACGCCCTTGGTCCCCCAGAGCGGTCGAATGCTGACCCCATGGCATTCGGT
CCTCGTTCGAGCTGTTGATGGAACGATAACCATGTCCCACGTTTCAGCCGTCGACAACTCAACTCATGAACTAGT
TGTTGAACGTGACCGGCCCTCCTATTTCCGCGAGAAGTTCGACTTGTTCAACTGGCCCGGTCTCAATCTCCGCTT
CAAGTATCTCTGCCCAACAGGCATCTTAATCTCGGCCCGAGATCATGACCAGTCATACTCTTTCCAAGACGTCCC
AATACTCAAGATTCGAAGACTCGCTAAGGACTGTCGACACTCGTCCGACTGGGAATCACGCTTGAATCACACCTC
TTTAGTCTCGCCTCATCCCGAAACCGGAGAAGACTGCCGCCACTTTCTCGAACCGTGGCCGCAGTGCAAGACAAG
TTTGCCTTTAACAAAATCTCTATCGGGAACAGGCCTCAGTGGTATATCCGCCTTCTCACCGACATGCTGTACGAC
CGTCGGGTAACGCTCTGGTTTGCATGGTCCGTCGGCGATGTCATCGTGTCAGACAACCTTACGACGCTACAGTCG
TACTGCGTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail