Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7326
Gene name
LocationContig_90:26326..27709
Strand-
Gene length (bp)1383
Transcript length (bp)1329
Coding sequence length (bp)1329
Protein length (aa) 443

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07767 Nop53 Nop53 (60S ribosomal biogenesis) 1.7E-104 22 409

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9UUI4|YIY9_SCHPO Uncharacterized protein C22F8.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22F8.09 PE=1 SV=1 14 442 3.0E-35
sp|Q12080|NOP53_YEAST Ribosome biogenesis protein NOP53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOP53 PE=1 SV=1 12 440 4.0E-21
sp|Q9NZM5|GSCR2_HUMAN Glioma tumor suppressor candidate region gene 2 protein OS=Homo sapiens GN=GLTSCR2 PE=1 SV=2 37 442 5.0E-16
sp|Q9W3C2|GSCR2_DROME Uncharacterized protein CG1785 OS=Drosophila melanogaster GN=CG1785 PE=2 SV=1 28 439 4.0E-09
sp|Q9NEU5|GSCR2_CAEEL Uncharacterized protein Y39B6A.33 OS=Caenorhabditis elegans GN=Y39B6A.33 PE=3 SV=1 22 441 3.0E-08

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5724
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7119
Ophiocordyceps australis map64 (Brazil) OphauB2|5501
Ophiocordyceps camponoti-floridani Ophcf2|05594
Ophiocordyceps camponoti-rufipedis Ophun1|7326 (this protein)
Ophiocordyceps kimflemingae Ophio5|3202
Ophiocordyceps subramaniannii Hirsu2|8973

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7326
MPIIHGPQGESTAAPEQHGQPSRKGKKAWRKNVDVSEVEQGLRALNEEIIRGGVIKEKPSSELFTIDVQGKAKST
RVARRRAKGTLKADEILAQRSLVPAVSARKRPADRMSDGLVAPKRQRTDWVSHKELARLKRVADGHHDATLAVRE
AQYDIWDVVAPSPAPETSGFIPEPQVAKVPKSMKRKPISLAASGKQVPAVRNPGGGHSYNPLFTDYEKRLVEEGA
KAVEAEKARLAAEEADRKKQEAAARSAAEAEAAEARAELSEWDEDSEWEGFQSGAEDGRANSKQPRRKTQAQRNS
IKRRKEEERLAKQKAALKARRLQEQNIAEIVEQVEDRQRSRALVHKPESDQGSDDDDEDDGDTPLRRKQLGKFRL
PQQDLALVLPDELQESLRLLKPEGNLLKDRYRSMLMRGKVESRRRIPFRKQAKRKVTEKWTHKDFVL*
Coding >Ophun1|7326
ATGCCCATCATTCACGGTCCTCAGGGAGAGTCGACCGCTGCGCCGGAGCAACATGGTCAGCCGTCGAGAAAAGGC
AAGAAGGCGTGGAGGAAGAATGTCGACGTCTCCGAGGTTGAGCAGGGTCTGCGAGCCCTGAACGAGGAGATTATC
CGAGGCGGCGTCATTAAAGAGAAGCCTTCGTCCGAACTCTTCACCATTGATGTCCAAGGCAAGGCCAAGTCGACC
CGCGTTGCTCGCAGGCGCGCAAAGGGAACTCTCAAAGCCGACGAGATCCTCGCCCAGCGCTCGCTCGTCCCCGCA
GTTTCGGCCCGCAAACGTCCCGCTGACAGAATGTCTGACGGTCTGGTGGCTCCGAAGCGTCAGAGAACCGATTGG
GTGTCGCACAAGGAGCTGGCTCGCCTCAAGCGCGTCGCCGACGGTCATCACGATGCCACCCTCGCCGTCAGAGAA
GCTCAGTACGACATCTGGGACGTCGTCGCTCCATCGCCCGCTCCCGAAACCTCTGGCTTCATCCCTGAGCCTCAA
GTGGCCAAGGTACCCAAGTCGATGAAACGAAAGCCCATATCACTTGCGGCCAGTGGGAAGCAGGTGCCAGCGGTG
CGCAACCCCGGCGGCGGCCACAGCTACAACCCACTATTCACCGACTACGAGAAACGGCTGGTCGAGGAGGGCGCC
AAAGCGGTGGAAGCGGAAAAGGCGCGACTCGCCGCCGAAGAAGCCGACAGAAAGAAGCAAGAGGCCGCAGCCCGA
TCCGCCGCCGAGGCCGAAGCCGCCGAAGCCCGCGCCGAACTGTCGGAATGGGACGAAGACTCCGAGTGGGAAGGT
TTCCAGAGCGGTGCCGAAGACGGCAGAGCAAACAGCAAGCAACCCAGGCGCAAAACCCAGGCGCAGCGCAACAGC
ATCAAGCGCAGAAAAGAGGAAGAGCGTCTCGCCAAGCAAAAAGCCGCCCTCAAGGCACGCCGCCTACAGGAGCAG
AACATTGCCGAGATTGTCGAGCAGGTCGAAGACCGCCAACGGAGCAGGGCTCTCGTCCACAAGCCCGAGTCGGAT
CAAGGCAGCGACGATGACGACGAGGATGACGGCGATACCCCCTTGCGAAGGAAGCAGCTCGGCAAGTTTAGACTC
CCGCAGCAGGATCTGGCGCTCGTGCTGCCGGATGAGTTGCAGGAGTCGCTCAGGCTGCTCAAGCCGGAGGGGAAC
CTTCTCAAGGATCGATATCGCAGCATGCTCATGCGTGGCAAGGTCGAGAGCCGAAGACGGATTCCGTTCAGGAAG
CAGGCCAAGCGCAAGGTCACGGAGAAGTGGACGCACAAGGATTTTGTGCTGTAG
Transcript >Ophun1|7326
ATGCCCATCATTCACGGTCCTCAGGGAGAGTCGACCGCTGCGCCGGAGCAACATGGTCAGCCGTCGAGAAAAGGC
AAGAAGGCGTGGAGGAAGAATGTCGACGTCTCCGAGGTTGAGCAGGGTCTGCGAGCCCTGAACGAGGAGATTATC
CGAGGCGGCGTCATTAAAGAGAAGCCTTCGTCCGAACTCTTCACCATTGATGTCCAAGGCAAGGCCAAGTCGACC
CGCGTTGCTCGCAGGCGCGCAAAGGGAACTCTCAAAGCCGACGAGATCCTCGCCCAGCGCTCGCTCGTCCCCGCA
GTTTCGGCCCGCAAACGTCCCGCTGACAGAATGTCTGACGGTCTGGTGGCTCCGAAGCGTCAGAGAACCGATTGG
GTGTCGCACAAGGAGCTGGCTCGCCTCAAGCGCGTCGCCGACGGTCATCACGATGCCACCCTCGCCGTCAGAGAA
GCTCAGTACGACATCTGGGACGTCGTCGCTCCATCGCCCGCTCCCGAAACCTCTGGCTTCATCCCTGAGCCTCAA
GTGGCCAAGGTACCCAAGTCGATGAAACGAAAGCCCATATCACTTGCGGCCAGTGGGAAGCAGGTGCCAGCGGTG
CGCAACCCCGGCGGCGGCCACAGCTACAACCCACTATTCACCGACTACGAGAAACGGCTGGTCGAGGAGGGCGCC
AAAGCGGTGGAAGCGGAAAAGGCGCGACTCGCCGCCGAAGAAGCCGACAGAAAGAAGCAAGAGGCCGCAGCCCGA
TCCGCCGCCGAGGCCGAAGCCGCCGAAGCCCGCGCCGAACTGTCGGAATGGGACGAAGACTCCGAGTGGGAAGGT
TTCCAGAGCGGTGCCGAAGACGGCAGAGCAAACAGCAAGCAACCCAGGCGCAAAACCCAGGCGCAGCGCAACAGC
ATCAAGCGCAGAAAAGAGGAAGAGCGTCTCGCCAAGCAAAAAGCCGCCCTCAAGGCACGCCGCCTACAGGAGCAG
AACATTGCCGAGATTGTCGAGCAGGTCGAAGACCGCCAACGGAGCAGGGCTCTCGTCCACAAGCCCGAGTCGGAT
CAAGGCAGCGACGATGACGACGAGGATGACGGCGATACCCCCTTGCGAAGGAAGCAGCTCGGCAAGTTTAGACTC
CCGCAGCAGGATCTGGCGCTCGTGCTGCCGGATGAGTTGCAGGAGTCGCTCAGGCTGCTCAAGCCGGAGGGGAAC
CTTCTCAAGGATCGATATCGCAGCATGCTCATGCGTGGCAAGGTCGAGAGCCGAAGACGGATTCCGTTCAGGAAG
CAGGCCAAGCGCAAGGTCACGGAGAAGTGGACGCACAAGGATTTTGTGCTGTAG
Gene >Ophun1|7326
ATGCCCATCATTCACGGTCCTCAGGGAGAGTCGACCGCTGCGCCGGAGCAACATGGTCAGCCGTCGAGAAAAGGC
AAGAAGGCGTGGAGGAAGAATGTCGACGTCTCCGAGGTTGAGCAGGGTCTGCGAGCCCTGAACGAGGAGATTATC
CGAGGGTGAGGCTCCCTGTCTCGTTGGAAATCGCATTGCAAGACTAAATCTTTTGGCAGCGGCGTCATTAAAGAG
AAGCCTTCGTCCGAACTCTTCACCATTGATGTCCAAGGCAAGGCCAAGTCGACCCGCGTTGCTCGCAGGCGCGCA
AAGGGAACTCTCAAAGCCGACGAGATCCTCGCCCAGCGCTCGCTCGTCCCCGCAGTTTCGGCCCGCAAACGTCCC
GCTGACAGAATGTCTGACGGTCTGGTGGCTCCGAAGCGTCAGAGAACCGATTGGGTGTCGCACAAGGAGCTGGCT
CGCCTCAAGCGCGTCGCCGACGGTCATCACGATGCCACCCTCGCCGTCAGAGAAGCTCAGTACGACATCTGGGAC
GTCGTCGCTCCATCGCCCGCTCCCGAAACCTCTGGCTTCATCCCTGAGCCTCAAGTGGCCAAGGTACCCAAGTCG
ATGAAACGAAAGCCCATATCACTTGCGGCCAGTGGGAAGCAGGTGCCAGCGGTGCGCAACCCCGGCGGCGGCCAC
AGCTACAACCCACTATTCACCGACTACGAGAAACGGCTGGTCGAGGAGGGCGCCAAAGCGGTGGAAGCGGAAAAG
GCGCGACTCGCCGCCGAAGAAGCCGACAGAAAGAAGCAAGAGGCCGCAGCCCGATCCGCCGCCGAGGCCGAAGCC
GCCGAAGCCCGCGCCGAACTGTCGGAATGGGACGAAGACTCCGAGTGGGAAGGTTTCCAGAGCGGTGCCGAAGAC
GGCAGAGCAAACAGCAAGCAACCCAGGCGCAAAACCCAGGCGCAGCGCAACAGCATCAAGCGCAGAAAAGAGGAA
GAGCGTCTCGCCAAGCAAAAAGCCGCCCTCAAGGCACGCCGCCTACAGGAGCAGAACATTGCCGAGATTGTCGAG
CAGGTCGAAGACCGCCAACGGAGCAGGGCTCTCGTCCACAAGCCCGAGTCGGATCAAGGCAGCGACGATGACGAC
GAGGATGACGGCGATACCCCCTTGCGAAGGAAGCAGCTCGGCAAGTTTAGACTCCCGCAGCAGGATCTGGCGCTC
GTGCTGCCGGATGAGTTGCAGGAGTCGCTCAGGCTGCTCAAGCCGGAGGGGAACCTTCTCAAGGATCGATATCGC
AGCATGCTCATGCGTGGCAAGGTCGAGAGCCGAAGACGGATTCCGTTCAGGAAGCAGGCCAAGCGCAAGGTCACG
GAGAAGTGGACGCACAAGGATTTTGTGCTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail