Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7322
Gene name
LocationContig_90:17847..18316
Strand-
Gene length (bp)469
Transcript length (bp)234
Coding sequence length (bp)234
Protein length (aa) 78

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10791 F1F0-ATPsyn_F Mitochondrial F1-F0 ATP synthase subunit F of fungi 1.2E-27 4 71

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q06405|ATPK_YEAST ATP synthase subunit f, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATP17 PE=1 SV=1 4 71 1.0E-19
sp|O94377|ATPK_SCHPO ATP synthase subunit f, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atp17 PE=3 SV=1 9 69 5.0E-12

GO

GO Term Description Terminal node
GO:0015986 proton motive force-driven ATP synthesis Yes
GO:0000276 mitochondrial proton-transporting ATP synthase complex, coupling factor F(o) Yes
GO:0009152 purine ribonucleotide biosynthetic process No
GO:0019693 ribose phosphate metabolic process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0006164 purine nucleotide biosynthetic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0009145 purine nucleoside triphosphate biosynthetic process No
GO:0009201 ribonucleoside triphosphate biosynthetic process No
GO:0032991 protein-containing complex No
GO:0009165 nucleotide biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0009205 purine ribonucleoside triphosphate metabolic process No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0033177 proton-transporting two-sector ATPase complex, proton-transporting domain No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0098796 membrane protein complex No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0045263 proton-transporting ATP synthase complex, coupling factor F(o) No
GO:0098798 mitochondrial protein-containing complex No
GO:0090407 organophosphate biosynthetic process No
GO:0072522 purine-containing compound biosynthetic process No
GO:0008152 metabolic process No
GO:0009058 biosynthetic process No
GO:0009259 ribonucleotide metabolic process No
GO:0009987 cellular process No
GO:0009206 purine ribonucleoside triphosphate biosynthetic process No
GO:0009260 ribonucleotide biosynthetic process No
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:0046034 ATP metabolic process No
GO:0009142 nucleoside triphosphate biosynthetic process No
GO:0098800 inner mitochondrial membrane protein complex No
GO:0071704 organic substance metabolic process No
GO:0046390 ribose phosphate biosynthetic process No
GO:0044281 small molecule metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0009199 ribonucleoside triphosphate metabolic process No
GO:0008150 biological_process No
GO:0046483 heterocycle metabolic process No
GO:1901293 nucleoside phosphate biosynthetic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0006754 ATP biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0009144 purine nucleoside triphosphate metabolic process No
GO:0009150 purine ribonucleotide metabolic process No
GO:0006753 nucleoside phosphate metabolic process No
GO:0009141 nucleoside triphosphate metabolic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0006163 purine nucleotide metabolic process No
GO:0072521 purine-containing compound metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0005575 cellular_component No
GO:0006793 phosphorus metabolic process No
GO:0009117 nucleotide metabolic process No
GO:0006807 nitrogen compound metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6300
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|5496
Ophiocordyceps camponoti-floridani Ophcf2|05599
Ophiocordyceps camponoti-rufipedis Ophun1|7322 (this protein)
Ophiocordyceps kimflemingae Ophio5|3197
Ophiocordyceps subramaniannii Hirsu2|8968

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7322
MSFVTRRALSTLIPPKVASPKAIGGAPDALRMQRVVSFYEKLPRGPAPEVKAKGLLGRYQAKYFGDKTSVKRMPY
TT*
Coding >Ophun1|7322
ATGAGCTTCGTCACGCGTCGAGCGCTTTCCACGCTCATTCCCCCGAAGGTCGCCTCGCCAAAGGCCATCGGCGGC
GCTCCCGATGCGTTGCGGATGCAGCGCGTCGTCAGCTTCTACGAAAAGCTTCCTCGGGGTCCGGCTCCGGAGGTC
AAGGCCAAAGGACTGCTCGGCCGATACCAGGCCAAATACTTTGGCGACAAGACGTCTGTGAAGCGTATGCCATAC
ACCACCTGA
Transcript >Ophun1|7322
ATGAGCTTCGTCACGCGTCGAGCGCTTTCCACGCTCATTCCCCCGAAGGTCGCCTCGCCAAAGGCCATCGGCGGC
GCTCCCGATGCGTTGCGGATGCAGCGCGTCGTCAGCTTCTACGAAAAGCTTCCTCGGGGTCCGGCTCCGGAGGTC
AAGGCCAAAGGACTGCTCGGCCGATACCAGGCCAAATACTTTGGCGACAAGACGTCTGTGAAGCGTATGCCATAC
ACCACCTGA
Gene >Ophun1|7322
ATGAGCTTCGTCACGCGTCGAGCGCTTTCCACGCTCATTCCCCCGAAGGTAGGGACGTTGAATCACAGCTCCATT
GCCAGCTGCTGACGCTACTCGCAGGTCGCCTCGCCAAAGGTACCTACCCAGCATCCCCTCCTTTTCCGAATTACG
TCGATCTATGGCCAGCATGCTGCGGACGCCGACGGAGAGAAGACTTGAGCGGCCTGGGAGTGTCTCGCTGTCGGC
GACGGACCTTGATCTATTCGACAATGAGCATACGGAAGATGGCTGAACCCATGGGCTGACTCTTGGCTCGCAGGC
CATCGGCGGCGCTCCCGATGCGTTGCGGATGCAGCGCGTCGTCAGCTTCTACGAAAAGCTTCCTCGGGGTCCGGC
TCCGGAGGTCAAGGCCAAAGGACTGCTCGGCCGATACCAGGCCAAATACTTTGGCGACAAGACGTCTGTGAAGCG
TATGCCATACACCACCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail