Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7317
Gene name
LocationContig_90:4493..5501
Strand+
Gene length (bp)1008
Transcript length (bp)1008
Coding sequence length (bp)1008
Protein length (aa) 336

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00929 RNase_T Exonuclease 1.3E-13 134 283

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IEV5|REXO4_GIBZE RNA exonuclease 4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=REX4 PE=3 SV=1 1 301 1.0E-122
sp|Q7S9B7|REXO4_NEUCR RNA exonuclease 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rex-4 PE=3 SV=1 129 298 2.0E-71
sp|Q4WHF8|REXO4_ASPFU RNA exonuclease 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rex4 PE=3 SV=1 1 299 3.0E-69
sp|Q6BIK6|REXO4_DEBHA RNA exonuclease 4 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=REX4 PE=3 SV=2 4 301 5.0E-65
sp|Q6FQA0|REXO4_CANGA RNA exonuclease 4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=REX4 PE=3 SV=1 128 298 1.0E-62
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IEV5|REXO4_GIBZE RNA exonuclease 4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=REX4 PE=3 SV=1 1 301 1.0E-122
sp|Q7S9B7|REXO4_NEUCR RNA exonuclease 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rex-4 PE=3 SV=1 129 298 2.0E-71
sp|Q4WHF8|REXO4_ASPFU RNA exonuclease 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rex4 PE=3 SV=1 1 299 3.0E-69
sp|Q6BIK6|REXO4_DEBHA RNA exonuclease 4 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=REX4 PE=3 SV=2 4 301 5.0E-65
sp|Q6FQA0|REXO4_CANGA RNA exonuclease 4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=REX4 PE=3 SV=1 128 298 1.0E-62
sp|Q08237|REXO4_YEAST RNA exonuclease 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=REX4 PE=1 SV=1 4 298 6.0E-61
sp|Q6CMT3|REXO4_KLULA RNA exonuclease 4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=REX4 PE=3 SV=1 95 307 5.0E-57
sp|Q757I9|REXO4_ASHGO RNA exonuclease 4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=REX4 PE=3 SV=1 129 302 3.0E-56
sp|Q4PER6|REXO4_USTMA RNA exonuclease 4 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=REX4 PE=3 SV=1 130 291 2.0E-53
sp|O94375|REXO4_SCHPO RNA exonuclease 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rex4 PE=3 SV=1 129 291 4.0E-52
sp|Q5A3Q0|REXO4_CANAL RNA exonuclease 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=REX4 PE=3 SV=1 130 297 8.0E-52
sp|P0CQ44|REXO4_CRYNJ RNA exonuclease 4 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=REX4 PE=3 SV=1 120 291 4.0E-47
sp|P0CQ45|REXO4_CRYNB RNA exonuclease 4 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=REX4 PE=3 SV=1 120 291 4.0E-47
sp|Q91560|REXO4_XENLA RNA exonuclease 4 OS=Xenopus laevis GN=rexo4 PE=2 SV=2 133 292 9.0E-46
sp|Q6DEW6|REXO4_XENTR RNA exonuclease 4 OS=Xenopus tropicalis GN=rexo4 PE=2 SV=1 133 292 2.0E-45
sp|Q6CE69|REXO4_YARLI RNA exonuclease 4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=REX4 PE=3 SV=1 130 290 1.0E-43
sp|Q9GZR2|REXO4_HUMAN RNA exonuclease 4 OS=Homo sapiens GN=REXO4 PE=1 SV=2 131 299 4.0E-43
sp|Q6PAQ4|REXO4_MOUSE RNA exonuclease 4 OS=Mus musculus GN=Rexo4 PE=2 SV=2 131 297 6.0E-43
sp|Q96AZ6|ISG20_HUMAN Interferon-stimulated gene 20 kDa protein OS=Homo sapiens GN=ISG20 PE=1 SV=2 131 284 2.0E-32
sp|Q66UW5|ISG20_PIG Interferon-stimulated gene 20 kDa protein OS=Sus scrofa GN=Isg20 PE=1 SV=2 131 284 2.0E-31
sp|Q8WTP8|AEN_HUMAN Apoptosis-enhancing nuclease OS=Homo sapiens GN=AEN PE=1 SV=2 109 284 5.0E-31
sp|Q2YDK1|I20L2_BOVIN Interferon-stimulated 20 kDa exonuclease-like 2 OS=Bos taurus GN=ISG20L2 PE=2 SV=1 122 284 8.0E-30
sp|Q5REE2|AEN_PONAB Apoptosis-enhancing nuclease OS=Pongo abelii GN=AEN PE=2 SV=1 67 284 1.0E-29
sp|Q9H9L3|I20L2_HUMAN Interferon-stimulated 20 kDa exonuclease-like 2 OS=Homo sapiens GN=ISG20L2 PE=1 SV=1 131 284 5.0E-29
sp|B2GUW6|AEN_RAT Apoptosis-enhancing nuclease OS=Rattus norvegicus GN=Aen PE=2 SV=1 131 304 8.0E-29
sp|Q3U1G5|I20L2_MOUSE Interferon-stimulated 20 kDa exonuclease-like 2 OS=Mus musculus GN=Isg20l2 PE=1 SV=2 130 284 4.0E-28
sp|Q6AXU3|I20L2_RAT Interferon-stimulated 20 kDa exonuclease-like 2 OS=Rattus norvegicus GN=Isg20l2 PE=2 SV=1 131 284 4.0E-28
sp|Q9CZI9|AEN_MOUSE Apoptosis-enhancing nuclease OS=Mus musculus GN=Aen PE=2 SV=1 131 284 1.0E-26
sp|Q9JL16|ISG20_MOUSE Interferon-stimulated gene 20 kDa protein OS=Mus musculus GN=Isg20 PE=1 SV=1 129 261 6.0E-25
sp|P53331|REXO1_YEAST RNA exonuclease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RNH70 PE=1 SV=1 132 282 6.0E-19
sp|Q54U94|REXO4_DICDI RNA exonuclease 4 OS=Dictyostelium discoideum GN=rexo4 PE=3 SV=1 112 298 1.0E-18
sp|Q8L7M4|SDN5_ARATH Small RNA degrading nuclease 5 OS=Arabidopsis thaliana GN=SDN5 PE=2 SV=2 131 280 2.0E-18
sp|Q6FIU7|REXO3_CANGA RNA exonuclease 3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=REX3 PE=3 SV=1 133 280 2.0E-18
sp|Q6CFE7|REXO3_YARLI RNA exonuclease 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=REX3 PE=3 SV=1 132 289 5.0E-18
sp|P48778|GOR_PANTR Exonuclease GOR OS=Pan troglodytes GN=REXO1L1 PE=2 SV=3 132 282 1.0E-17
sp|O94443|YFE9_SCHPO Uncharacterized exonuclease C637.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC637.09 PE=3 SV=2 131 284 1.0E-17
sp|A3KPE8|SDN1_ARATH Small RNA degrading nuclease 1 OS=Arabidopsis thaliana GN=SDN1 PE=2 SV=1 132 282 4.0E-17
sp|Q9FFG1|SDN2_ARATH Small RNA degrading nuclease 2 OS=Arabidopsis thaliana GN=SDN2 PE=2 SV=1 131 282 7.0E-17
sp|Q8IX06|GOR_HUMAN Putative exonuclease GOR OS=Homo sapiens GN=REXO1L1P PE=5 SV=2 132 282 9.0E-17
sp|Q8RXK2|SDN3_ARATH Small RNA degrading nuclease 3 OS=Arabidopsis thaliana GN=SDN3 PE=1 SV=1 124 282 1.0E-16
sp|Q7TT28|REXO1_MOUSE RNA exonuclease 1 homolog OS=Mus musculus GN=Rexo1 PE=1 SV=1 123 283 3.0E-16
sp|Q750A5|REXO3_ASHGO RNA exonuclease 3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=REX3 PE=3 SV=1 133 293 9.0E-16
sp|Q96IC2|REXON_HUMAN Putative RNA exonuclease NEF-sp OS=Homo sapiens GN=44M2.3 PE=2 SV=1 132 284 1.0E-15
sp|Q4R9F7|REXON_MACFA Putative RNA exonuclease NEF-sp OS=Macaca fascicularis GN=QtsA-10054 PE=2 SV=1 132 282 2.0E-15
sp|Q2T9U5|REXON_BOVIN Putative RNA exonuclease NEF-sp OS=Bos taurus PE=2 SV=1 132 284 3.0E-15
sp|Q12090|REXO3_YEAST RNA exonuclease 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=REX3 PE=1 SV=1 129 280 8.0E-14
sp|Q5APK0|PAN2_CANAL PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAN2 PE=3 SV=1 114 293 3.0E-13
sp|Q9P7H2|REXO3_SCHPO RNA exonuclease 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rex3 PE=3 SV=1 134 289 1.0E-12
sp|Q10124|PQE1_CAEEL Putative RNA exonuclease pqe-1 OS=Caenorhabditis elegans GN=pqe-1 PE=3 SV=2 131 283 2.0E-12
sp|Q754X1|PAN2_ASHGO PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PAN2 PE=3 SV=2 130 286 5.0E-12
sp|Q6CJB5|REXO3_KLULA RNA exonuclease 3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=REX3 PE=3 SV=1 133 280 2.0E-11
sp|A5DAD0|PAN2_PICGU PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PAN2 PE=3 SV=3 113 287 2.0E-11
sp|P53010|PAN2_YEAST PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAN2 PE=1 SV=1 130 286 2.0E-11
sp|Q8N1G1|REXO1_HUMAN RNA exonuclease 1 homolog OS=Homo sapiens GN=REXO1 PE=1 SV=3 132 283 3.0E-11
sp|Q6FS70|PAN2_CANGA PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PAN2 PE=3 SV=1 124 286 2.0E-10
sp|A5E1W0|PAN2_LODEL PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PAN2 PE=3 SV=1 161 286 9.0E-10
sp|Q8BGF7|PAN2_MOUSE PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Mus musculus GN=Pan2 PE=1 SV=1 123 286 5.0E-09
sp|Q6IE70|PAN2_RAT PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Rattus norvegicus GN=Pan2 PE=2 SV=1 123 286 5.0E-09
sp|Q504Q3|PAN2_HUMAN PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Homo sapiens GN=PAN2 PE=1 SV=3 123 286 6.0E-09
sp|Q9SN09|SDN4_ARATH Putative small RNA degrading nuclease 4 OS=Arabidopsis thaliana GN=SDN4 PE=3 SV=1 130 275 7.0E-09
sp|Q5F450|PAN2_CHICK PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Gallus gallus GN=PAN2 PE=2 SV=1 123 286 1.0E-08
sp|Q0UPL5|PAN2_PHANO PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAN2 PE=3 SV=1 130 292 2.0E-08
sp|Q6CMN5|PAN2_KLULA PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PAN2 PE=3 SV=1 132 286 2.0E-08
sp|P0C581|PAN2_NEUCR PAB-dependent poly(A)-specific ribonuclease subunit pan2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pan2 PE=1 SV=2 150 287 4.0E-08
sp|Q6C462|PAN2_YARLI PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAN2 PE=3 SV=2 150 287 7.0E-08
sp|Q2GSV2|PAN2_CHAGB PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAN2 PE=3 SV=2 150 292 1.0E-07
sp|A3LRV8|PAN2_PICST PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PAN2 PE=3 SV=2 125 286 2.0E-07
sp|P0CQ08|PAN2_CRYNJ PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAN2 PE=3 SV=1 130 284 4.0E-07
sp|P0CQ09|PAN2_CRYNB PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAN2 PE=3 SV=1 130 284 4.0E-07
sp|A4RF51|PAN2_MAGO7 PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAN2 PE=3 SV=3 130 292 4.0E-07
sp|Q6BZ78|PAN2_DEBHA PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PAN2 PE=3 SV=2 130 276 6.0E-07
sp|P53015|YPO4_CAEEL Uncharacterized protein F31E3.4 OS=Caenorhabditis elegans GN=F31E3.4 PE=4 SV=1 150 286 3.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5716
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7128
Ophiocordyceps australis map64 (Brazil) OphauB2|1135
Ophiocordyceps camponoti-floridani Ophcf2|05604
Ophiocordyceps camponoti-rufipedis Ophun1|7317 (this protein)
Ophiocordyceps kimflemingae Ophio5|6446
Ophiocordyceps subramaniannii Hirsu2|8963

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7317
MDDLSSNWKKLQALLYPGKTLTPSSKRKADNSSTPQRQAKNQKLAVNPITTAHERDTNLSGRPSMGGVHSSPVQF
ETRNGPSPSPALWTGDDPVSSETLADAYKLGLKGDATAKKADRLNYGLSEGIQVGKFLALDCEMVGVGSGGYESA
LARVSVVDFHGQQIYDSFVKPKERVTDWRTPVSGVSPKDMRMARDFKEVQAQISDLLKDRVLVGHDIKHDLTALK
LSHPARDIRDTALYPGFKQYAYGRKPALRVLAKQLLGTSLHDGAHSSVEDARATMLLFRNHKSGFDADHANRFPS
KKGPTTQDKRKKADKGKKALKTKKGGPPKAKDCLG*
Coding >Ophun1|7317
ATGGACGACTTATCCTCCAACTGGAAGAAGCTCCAGGCTCTGCTCTACCCCGGAAAGACTCTGACGCCCTCATCG
AAACGAAAAGCCGATAACTCGTCCACTCCTCAGCGTCAAGCCAAGAATCAGAAACTCGCCGTCAACCCCATCACT
ACCGCCCACGAACGAGACACGAACCTATCGGGCCGACCTAGTATGGGCGGCGTACACAGCTCTCCCGTTCAATTC
GAGACTCGAAACGGCCCTTCCCCTTCACCTGCCCTATGGACCGGAGACGACCCAGTCTCGTCCGAAACACTGGCC
GATGCCTACAAGCTTGGTCTCAAGGGAGACGCCACGGCTAAGAAAGCCGATCGCCTCAATTACGGTCTTTCTGAA
GGCATCCAAGTTGGAAAATTTCTGGCCTTGGACTGTGAGATGGTGGGCGTCGGCTCGGGGGGCTACGAGTCGGCT
CTGGCTAGAGTCAGCGTCGTCGACTTCCACGGGCAACAGATATACGACTCGTTTGTGAAGCCGAAAGAGAGAGTG
ACTGATTGGAGGACCCCAGTGAGCGGCGTCTCTCCCAAAGATATGCGAATGGCACGGGATTTCAAAGAGGTTCAA
GCTCAGATATCTGATCTTCTAAAAGATCGCGTACTGGTGGGACACGACATCAAACATGACCTGACGGCTCTCAAG
CTCAGCCACCCGGCCCGGGATATTCGTGATACCGCACTGTACCCCGGCTTCAAGCAATACGCATACGGTCGAAAA
CCGGCTCTGAGGGTACTGGCGAAACAACTGCTCGGCACCAGCCTCCACGATGGAGCCCATTCCAGTGTCGAGGAT
GCCCGGGCCACGATGCTTCTTTTCCGCAACCACAAGTCTGGCTTCGATGCCGACCACGCCAACCGGTTCCCCTCG
AAGAAAGGTCCAACCACCCAGGACAAGAGGAAGAAGGCGGACAAGGGGAAGAAGGCCCTCAAGACTAAAAAGGGA
GGACCTCCGAAGGCGAAAGACTGTTTGGGTTGA
Transcript >Ophun1|7317
ATGGACGACTTATCCTCCAACTGGAAGAAGCTCCAGGCTCTGCTCTACCCCGGAAAGACTCTGACGCCCTCATCG
AAACGAAAAGCCGATAACTCGTCCACTCCTCAGCGTCAAGCCAAGAATCAGAAACTCGCCGTCAACCCCATCACT
ACCGCCCACGAACGAGACACGAACCTATCGGGCCGACCTAGTATGGGCGGCGTACACAGCTCTCCCGTTCAATTC
GAGACTCGAAACGGCCCTTCCCCTTCACCTGCCCTATGGACCGGAGACGACCCAGTCTCGTCCGAAACACTGGCC
GATGCCTACAAGCTTGGTCTCAAGGGAGACGCCACGGCTAAGAAAGCCGATCGCCTCAATTACGGTCTTTCTGAA
GGCATCCAAGTTGGAAAATTTCTGGCCTTGGACTGTGAGATGGTGGGCGTCGGCTCGGGGGGCTACGAGTCGGCT
CTGGCTAGAGTCAGCGTCGTCGACTTCCACGGGCAACAGATATACGACTCGTTTGTGAAGCCGAAAGAGAGAGTG
ACTGATTGGAGGACCCCAGTGAGCGGCGTCTCTCCCAAAGATATGCGAATGGCACGGGATTTCAAAGAGGTTCAA
GCTCAGATATCTGATCTTCTAAAAGATCGCGTACTGGTGGGACACGACATCAAACATGACCTGACGGCTCTCAAG
CTCAGCCACCCGGCCCGGGATATTCGTGATACCGCACTGTACCCCGGCTTCAAGCAATACGCATACGGTCGAAAA
CCGGCTCTGAGGGTACTGGCGAAACAACTGCTCGGCACCAGCCTCCACGATGGAGCCCATTCCAGTGTCGAGGAT
GCCCGGGCCACGATGCTTCTTTTCCGCAACCACAAGTCTGGCTTCGATGCCGACCACGCCAACCGGTTCCCCTCG
AAGAAAGGTCCAACCACCCAGGACAAGAGGAAGAAGGCGGACAAGGGGAAGAAGGCCCTCAAGACTAAAAAGGGA
GGACCTCCGAAGGCGAAAGACTGTTTGGGTTGA
Gene >Ophun1|7317
ATGGACGACTTATCCTCCAACTGGAAGAAGCTCCAGGCTCTGCTCTACCCCGGAAAGACTCTGACGCCCTCATCG
AAACGAAAAGCCGATAACTCGTCCACTCCTCAGCGTCAAGCCAAGAATCAGAAACTCGCCGTCAACCCCATCACT
ACCGCCCACGAACGAGACACGAACCTATCGGGCCGACCTAGTATGGGCGGCGTACACAGCTCTCCCGTTCAATTC
GAGACTCGAAACGGCCCTTCCCCTTCACCTGCCCTATGGACCGGAGACGACCCAGTCTCGTCCGAAACACTGGCC
GATGCCTACAAGCTTGGTCTCAAGGGAGACGCCACGGCTAAGAAAGCCGATCGCCTCAATTACGGTCTTTCTGAA
GGCATCCAAGTTGGAAAATTTCTGGCCTTGGACTGTGAGATGGTGGGCGTCGGCTCGGGGGGCTACGAGTCGGCT
CTGGCTAGAGTCAGCGTCGTCGACTTCCACGGGCAACAGATATACGACTCGTTTGTGAAGCCGAAAGAGAGAGTG
ACTGATTGGAGGACCCCAGTGAGCGGCGTCTCTCCCAAAGATATGCGAATGGCACGGGATTTCAAAGAGGTTCAA
GCTCAGATATCTGATCTTCTAAAAGATCGCGTACTGGTGGGACACGACATCAAACATGACCTGACGGCTCTCAAG
CTCAGCCACCCGGCCCGGGATATTCGTGATACCGCACTGTACCCCGGCTTCAAGCAATACGCATACGGTCGAAAA
CCGGCTCTGAGGGTACTGGCGAAACAACTGCTCGGCACCAGCCTCCACGATGGAGCCCATTCCAGTGTCGAGGAT
GCCCGGGCCACGATGCTTCTTTTCCGCAACCACAAGTCTGGCTTCGATGCCGACCACGCCAACCGGTTCCCCTCG
AAGAAAGGTCCAACCACCCAGGACAAGAGGAAGAAGGCGGACAAGGGGAAGAAGGCCCTCAAGACTAAAAAGGGA
GGACCTCCGAAGGCGAAAGACTGTTTGGGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail