Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7314
Gene name
LocationContig_9:78275..78824
Strand+
Gene length (bp)549
Transcript length (bp)549
Coding sequence length (bp)549
Protein length (aa) 183

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 21 0.999696

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup569
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2676
Ophiocordyceps australis 1348a (Ghana) OphauG2|6197
Ophiocordyceps australis map64 (Brazil) OphauB2|4006
Ophiocordyceps camponoti-floridani Ophcf2|03295
Ophiocordyceps camponoti-rufipedis Ophun1|7314 (this protein)
Ophiocordyceps kimflemingae Ophio5|3542
Ophiocordyceps subramaniannii Hirsu2|5316
Ophiocordyceps subramaniannii Hirsu2|8001

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7314
MQTPRLSHLLAALLCATTSQANSPHTSTCYEGEGSNLHCYSGKDDTPQGVNVADVAEAAQALRAYGREESPGRFL
TMTAANAPDCAEWTIYELRSVLVLAKHIGSDKNSSVLFEDVASTIADEPGHGDDQNPILSCLAAGGSLGVRVNGS
SPAYKSDEYKKSGFSPEGIIIKIVSNGRKVDL*
Coding >Ophun1|7314
ATGCAAACTCCACGACTATCCCACCTCCTCGCAGCCCTCCTCTGCGCAACAACTTCCCAAGCCAACTCCCCCCAC
ACCTCAACCTGCTACGAAGGCGAAGGCTCCAACCTCCACTGCTACAGCGGCAAAGACGACACGCCGCAGGGCGTC
AATGTAGCCGACGTCGCCGAGGCCGCTCAGGCCCTTCGCGCCTATGGCCGTGAGGAAAGCCCCGGCCGCTTCCTC
ACCATGACGGCTGCCAATGCGCCCGACTGCGCGGAGTGGACTATCTATGAGCTTCGCTCTGTTCTTGTCCTGGCT
AAGCACATTGGCTCGGACAAGAATTCGTCTGTTCTGTTCGAGGATGTGGCCAGCACCATTGCCGATGAGCCTGGT
CATGGTGACGATCAGAACCCCATTCTCAGCTGTCTGGCTGCTGGTGGCTCACTTGGCGTCCGGGTCAACGGGTCC
AGTCCGGCGTACAAGTCGGACGAGTACAAGAAATCGGGCTTCTCGCCGGAAGGCATCATCATCAAGATTGTCTCC
AACGGACGCAAGGTCGATCTTTGA
Transcript >Ophun1|7314
ATGCAAACTCCACGACTATCCCACCTCCTCGCAGCCCTCCTCTGCGCAACAACTTCCCAAGCCAACTCCCCCCAC
ACCTCAACCTGCTACGAAGGCGAAGGCTCCAACCTCCACTGCTACAGCGGCAAAGACGACACGCCGCAGGGCGTC
AATGTAGCCGACGTCGCCGAGGCCGCTCAGGCCCTTCGCGCCTATGGCCGTGAGGAAAGCCCCGGCCGCTTCCTC
ACCATGACGGCTGCCAATGCGCCCGACTGCGCGGAGTGGACTATCTATGAGCTTCGCTCTGTTCTTGTCCTGGCT
AAGCACATTGGCTCGGACAAGAATTCGTCTGTTCTGTTCGAGGATGTGGCCAGCACCATTGCCGATGAGCCTGGT
CATGGTGACGATCAGAACCCCATTCTCAGCTGTCTGGCTGCTGGTGGCTCACTTGGCGTCCGGGTCAACGGGTCC
AGTCCGGCGTACAAGTCGGACGAGTACAAGAAATCGGGCTTCTCGCCGGAAGGCATCATCATCAAGATTGTCTCC
AACGGACGCAAGGTCGATCTTTGA
Gene >Ophun1|7314
ATGCAAACTCCACGACTATCCCACCTCCTCGCAGCCCTCCTCTGCGCAACAACTTCCCAAGCCAACTCCCCCCAC
ACCTCAACCTGCTACGAAGGCGAAGGCTCCAACCTCCACTGCTACAGCGGCAAAGACGACACGCCGCAGGGCGTC
AATGTAGCCGACGTCGCCGAGGCCGCTCAGGCCCTTCGCGCCTATGGCCGTGAGGAAAGCCCCGGCCGCTTCCTC
ACCATGACGGCTGCCAATGCGCCCGACTGCGCGGAGTGGACTATCTATGAGCTTCGCTCTGTTCTTGTCCTGGCT
AAGCACATTGGCTCGGACAAGAATTCGTCTGTTCTGTTCGAGGATGTGGCCAGCACCATTGCCGATGAGCCTGGT
CATGGTGACGATCAGAACCCCATTCTCAGCTGTCTGGCTGCTGGTGGCTCACTTGGCGTCCGGGTCAACGGGTCC
AGTCCGGCGTACAAGTCGGACGAGTACAAGAAATCGGGCTTCTCGCCGGAAGGCATCATCATCAAGATTGTCTCC
AACGGACGCAAGGTCGATCTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail