Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7302
Gene name
LocationContig_9:42723..44061
Strand-
Gene length (bp)1338
Transcript length (bp)1338
Coding sequence length (bp)1338
Protein length (aa) 446

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01529 DHHC DHHC palmitoyltransferase 3.0E-26 84 211

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IMZ7|PFA4_GIBZE Palmitoyltransferase PFA4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PFA4 PE=3 SV=1 1 430 0.0E+00
sp|Q7SCY6|PFA4_NEUCR Palmitoyltransferase pfa4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ptr-4 PE=3 SV=1 13 426 6.0E-126
sp|Q4WC37|PFA4_ASPFU Palmitoyltransferase pfa4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pfa4 PE=3 SV=2 10 425 3.0E-88
sp|Q5BD15|PFA4_EMENI Palmitoyltransferase pfa4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pfa4 PE=3 SV=1 10 424 3.0E-81
sp|Q6FVE6|PFA4_CANGA Palmitoyltransferase PFA4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PFA4 PE=3 SV=1 8 397 1.0E-37
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IMZ7|PFA4_GIBZE Palmitoyltransferase PFA4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PFA4 PE=3 SV=1 1 430 0.0E+00
sp|Q7SCY6|PFA4_NEUCR Palmitoyltransferase pfa4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ptr-4 PE=3 SV=1 13 426 6.0E-126
sp|Q4WC37|PFA4_ASPFU Palmitoyltransferase pfa4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pfa4 PE=3 SV=2 10 425 3.0E-88
sp|Q5BD15|PFA4_EMENI Palmitoyltransferase pfa4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pfa4 PE=3 SV=1 10 424 3.0E-81
sp|Q6FVE6|PFA4_CANGA Palmitoyltransferase PFA4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PFA4 PE=3 SV=1 8 397 1.0E-37
sp|Q12006|PFA4_YEAST Palmitoyltransferase PFA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFA4 PE=1 SV=1 8 397 4.0E-36
sp|Q6C7Q0|PFA4_YARLI Palmitoyltransferase PFA4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PFA4 PE=3 SV=1 44 393 1.0E-35
sp|Q6BLY8|PFA4_DEBHA Palmitoyltransferase PFA4 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PFA4 PE=3 SV=2 8 400 1.0E-34
sp|Q75CB4|PFA4_ASHGO Palmitoyltransferase PFA4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PFA4 PE=3 SV=2 1 397 1.0E-32
sp|Q6CUB5|PFA4_KLULA Palmitoyltransferase PFA4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PFA4 PE=3 SV=1 14 397 2.0E-32
sp|Q4PE27|PFA4_USTMA Palmitoyltransferase PFA4 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PFA4 PE=3 SV=2 20 319 4.0E-32
sp|J9VJ99|PFA4_CRYNH Palmitoyltransferase PFA4 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=PFA4 PE=1 SV=2 86 376 2.0E-31
sp|P0CS68|PFA4_CRYNJ Palmitoyltransferase PFA4 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PFA4 PE=3 SV=2 86 368 3.0E-30
sp|P0CS69|PFA4_CRYNB Palmitoyltransferase PFA4 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PFA4 PE=3 SV=1 86 368 3.0E-30
sp|Q5AGV7|PFA4_CANAL Palmitoyltransferase PFA4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PFA4 PE=3 SV=1 8 216 5.0E-23
sp|Q93VV0|ZDHC6_ARATH Probable protein S-acyltransferase 16 OS=Arabidopsis thaliana GN=PAT16 PE=2 SV=1 12 271 7.0E-19
sp|Q500Z2|ZDH20_ARATH Probable protein S-acyltransferase 15 OS=Arabidopsis thaliana GN=PAT15 PE=2 SV=1 66 275 3.0E-18
sp|Q4WZL8|PFA3_ASPFU Palmitoyltransferase pfa3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pfa3 PE=3 SV=1 54 219 1.0E-16
sp|Q86A83|ZDHC2_DICDI Putative ZDHHC-type palmitoyltransferase 2 OS=Dictyostelium discoideum GN=DDB_G0274739 PE=2 SV=2 55 151 3.0E-16
sp|C8VCL4|PFA3_EMENI Palmitoyltransferase pfa3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pfa3 PE=3 SV=2 21 219 4.0E-16
sp|Q5REH2|ZDHC6_PONAB Palmitoyltransferase ZDHHC6 OS=Pongo abelii GN=ZDHHC6 PE=3 SV=1 43 285 5.0E-16
sp|Q9H6R6|ZDHC6_HUMAN Palmitoyltransferase ZDHHC6 OS=Homo sapiens GN=ZDHHC6 PE=1 SV=1 43 285 5.0E-16
sp|Q2TGJ4|ZDH15_RAT Palmitoyltransferase ZDHHC15 OS=Rattus norvegicus GN=Zdhhc15 PE=2 SV=1 64 274 1.0E-15
sp|Q8BGJ0|ZDH15_MOUSE Palmitoyltransferase ZDHHC15 OS=Mus musculus GN=Zdhhc15 PE=1 SV=1 86 274 2.0E-15
sp|Q96MV8|ZDH15_HUMAN Palmitoyltransferase ZDHHC15 OS=Homo sapiens GN=ZDHHC15 PE=2 SV=1 86 274 2.0E-15
sp|Q94C49|ZDH18_ARATH Probable protein S-acyltransferase 13 OS=Arabidopsis thaliana GN=PAT13 PE=2 SV=1 51 270 3.0E-15
sp|O14345|PFA3_SCHPO Palmitoyltransferase pfa3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pfa3 PE=3 SV=1 61 328 5.0E-15
sp|Q8VYP5|ZDH14_ARATH Probable protein S-acyltransferase 14 OS=Arabidopsis thaliana GN=PAT14 PE=2 SV=1 46 242 6.0E-15
sp|Q9CPV7|ZDHC6_MOUSE Palmitoyltransferase ZDHHC6 OS=Mus musculus GN=Zdhhc6 PE=2 SV=1 43 290 1.0E-14
sp|Q5Y5T1|ZDH20_MOUSE Probable palmitoyltransferase ZDHHC20 OS=Mus musculus GN=Zdhhc20 PE=1 SV=1 86 236 2.0E-14
sp|Q2HJ95|ZDHC6_BOVIN Palmitoyltransferase ZDHHC6 OS=Bos taurus GN=ZDHHC6 PE=2 SV=1 43 290 2.0E-14
sp|Q555N7|ZDHC4_DICDI Putative ZDHHC-type palmitoyltransferase 4 OS=Dictyostelium discoideum GN=DDB_G0274251 PE=3 SV=1 76 141 2.0E-14
sp|Q5FWL7|ZDH15_XENLA Palmitoyltransferase ZDHHC15 OS=Xenopus laevis GN=zdhhc15 PE=2 SV=1 86 265 5.0E-14
sp|Q4P6L3|AKR1_USTMA Palmitoyltransferase AKR1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=AKR1 PE=3 SV=1 53 220 6.0E-14
sp|Q8R173|ZDHC3_MOUSE Palmitoyltransferase ZDHHC3 OS=Mus musculus GN=Zdhhc3 PE=1 SV=1 25 155 7.0E-14
sp|Q4IA62|PFA3_GIBZE Palmitoyltransferase PFA3 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PFA3 PE=3 SV=1 47 165 7.0E-14
sp|Q7S7C5|PFA3_NEUCR Palmitoyltransferase pfa3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ptr-3 PE=3 SV=3 54 142 7.0E-14
sp|Q5ADN9|PFA3_CANAL Palmitoyltransferase PFA3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PFA3 PE=3 SV=1 81 295 7.0E-14
sp|Q9NYG2|ZDHC3_HUMAN Palmitoyltransferase ZDHHC3 OS=Homo sapiens GN=ZDHHC3 PE=1 SV=2 44 155 8.0E-14
sp|Q9LIH7|ZDHC7_ARATH Protein S-acyltransferase 11 OS=Arabidopsis thaliana GN=PAT11 PE=2 SV=1 85 164 2.0E-13
sp|Q9NXF8|ZDHC7_HUMAN Palmitoyltransferase ZDHHC7 OS=Homo sapiens GN=ZDHHC7 PE=1 SV=2 44 140 2.0E-13
sp|Q923G5|ZDHC7_RAT Palmitoyltransferase ZDHHC7 OS=Rattus norvegicus GN=Zdhhc7 PE=1 SV=1 44 140 4.0E-13
sp|Q91WU6|ZDHC7_MOUSE Palmitoyltransferase ZDHHC7 OS=Mus musculus GN=Zdhhc7 PE=1 SV=1 44 140 4.0E-13
sp|Q5M757|ZDH15_ARATH Probable protein S-acyltransferase 12 OS=Arabidopsis thaliana GN=PAT12 PE=2 SV=1 50 122 6.0E-13
sp|P59267|ZDHC2_MOUSE Palmitoyltransferase ZDHHC2 OS=Mus musculus GN=Zdhhc2 PE=2 SV=1 86 137 1.0E-12
sp|Q9UIJ5|ZDHC2_HUMAN Palmitoyltransferase ZDHHC2 OS=Homo sapiens GN=ZDHHC2 PE=2 SV=1 86 137 1.0E-12
sp|Q9JKR5|ZDHC2_RAT Palmitoyltransferase ZDHHC2 OS=Rattus norvegicus GN=Zdhhc2 PE=2 SV=1 86 137 2.0E-12
sp|Q5A861|SWF1_CANAL Palmitoyltransferase SWF1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SWF1 PE=3 SV=1 10 145 2.0E-12
sp|Q58CU4|ZDH16_BOVIN Probable palmitoyltransferase ZDHHC16 OS=Bos taurus GN=ZDHHC16 PE=2 SV=1 55 146 2.0E-12
sp|Q8I0G4|ZDHC4_CAEEL Zinc finger DHHC domain-containing protein 4 OS=Caenorhabditis elegans GN=dhhc-4 PE=3 SV=1 86 148 3.0E-12
sp|Q969W1|ZDH16_HUMAN Probable palmitoyltransferase ZDHHC16 OS=Homo sapiens GN=ZDHHC16 PE=2 SV=1 55 146 3.0E-12
sp|Q4R7E2|ZDH16_MACFA Probable palmitoyltransferase ZDHHC16 OS=Macaca fascicularis GN=ZDHHC16 PE=2 SV=1 55 146 3.0E-12
sp|Q9ESG8|ZDH16_MOUSE Probable palmitoyltransferase ZDHHC16 OS=Mus musculus GN=Zdhhc16 PE=1 SV=2 55 285 4.0E-12
sp|Q7Z8U2|AKR1_ASPOR Palmitoyltransferase akr1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=akr1 PE=3 SV=2 42 155 5.0E-12
sp|Q75AW7|PFA3_ASHGO Palmitoyltransferase PFA3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PFA3 PE=3 SV=2 44 199 6.0E-12
sp|Q6BMV2|PFA3_DEBHA Palmitoyltransferase PFA3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PFA3 PE=3 SV=2 86 294 7.0E-12
sp|O60069|SWF1_SCHPO Palmitoyltransferase swf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swf1 PE=3 SV=1 85 182 7.0E-12
sp|Q4WUK1|PFA5_ASPFU Palmitoyltransferase pfa5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pfa5 PE=3 SV=2 79 274 9.0E-12
sp|Q6UX98|ZDH24_HUMAN Probable palmitoyltransferase ZDHHC24 OS=Homo sapiens GN=ZDHHC24 PE=1 SV=1 86 279 1.0E-11
sp|Q4I2M7|ERFB_GIBZE Palmitoyltransferase ERF2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ERF2 PE=3 SV=1 7 139 2.0E-11
sp|Q9UVH3|AKR1_MORAP Palmitoyltransferase AKR1 (Fragment) OS=Mortierella alpina PE=3 SV=1 60 216 2.0E-11
sp|Q6BP23|SWF1_DEBHA Palmitoyltransferase SWF1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SWF1 PE=3 SV=1 55 148 2.0E-11
sp|P0CS66|AKR1_CRYNJ Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=AKR1 PE=3 SV=1 57 220 2.0E-11
sp|P0CS67|AKR1_CRYNB Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=AKR1 PE=3 SV=1 57 220 2.0E-11
sp|Q6C7D1|PFA5_YARLI Palmitoyltransferase PFA5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PFA5 PE=3 SV=1 85 278 2.0E-11
sp|Q550R7|ZDHC1_DICDI Putative ZDHHC-type palmitoyltransferase 1 OS=Dictyostelium discoideum GN=DDB_G0276997 PE=3 SV=3 78 145 3.0E-11
sp|Q6FW70|PFA3_CANGA Palmitoyltransferase PFA3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PFA3 PE=3 SV=1 70 139 4.0E-11
sp|Q4X251|AKR1_ASPFU Palmitoyltransferase akr1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=akr1 PE=3 SV=2 43 141 6.0E-11
sp|Q4I8B6|AKR1_GIBZE Palmitoyltransferase AKR1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=AKR1 PE=3 SV=1 60 152 6.0E-11
sp|Q5FC64|ZDHCS_CAEEL Palmitoyltransferase spe-10 OS=Caenorhabditis elegans GN=spe-10 PE=1 SV=1 85 142 6.0E-11
sp|Q6CPU8|PFA3_KLULA Palmitoyltransferase PFA3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PFA3 PE=3 SV=1 83 211 6.0E-11
sp|O80685|ZDHC4_ARATH Probable protein S-acyltransferase 2 OS=Arabidopsis thaliana GN=PAT02 PE=2 SV=3 86 261 6.0E-11
sp|Q5B0V6|AKR1_EMENI Palmitoyltransferase akr1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=akr1 PE=3 SV=2 49 155 7.0E-11
sp|Q7SFL7|ERFB_NEUCR Palmitoyltransferase erf2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ptr-2 PE=3 SV=1 81 148 7.0E-11
sp|Q810M5|ZDH19_MOUSE Probable palmitoyltransferase ZDHHC19 OS=Mus musculus GN=Zdhhc19 PE=1 SV=1 73 175 9.0E-11
sp|Q8VDZ4|ZDHC5_MOUSE Palmitoyltransferase ZDHHC5 OS=Mus musculus GN=Zdhhc5 PE=1 SV=1 17 201 1.0E-10
sp|Q09701|AKR1_SCHPO Palmitoyltransferase akr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=akr1 PE=3 SV=1 62 162 2.0E-10
sp|Q2THW7|ZDHC5_RAT Palmitoyltransferase ZDHHC5 OS=Rattus norvegicus GN=Zdhhc5 PE=1 SV=1 17 201 2.0E-10
sp|Q3EBC2|ZDHC5_ARATH Probable protein S-acyltransferase 17 OS=Arabidopsis thaliana GN=PAT17 PE=2 SV=1 87 166 2.0E-10
sp|Q5B433|PFA5_EMENI Palmitoyltransferase pfa5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pfa5 PE=3 SV=2 79 218 2.0E-10
sp|Q5W0Z9|ZDH20_HUMAN Probable palmitoyltransferase ZDHHC20 OS=Homo sapiens GN=ZDHHC20 PE=1 SV=1 86 127 3.0E-10
sp|Q2THX1|ZDHC5_PANTR Palmitoyltransferase ZDHHC5 OS=Pan troglodytes GN=ZDHHC5 PE=2 SV=1 78 201 3.0E-10
sp|Q9C0B5|ZDHC5_HUMAN Palmitoyltransferase ZDHHC5 OS=Homo sapiens GN=ZDHHC5 PE=1 SV=2 78 201 3.0E-10
sp|Q6FXC6|SWF1_CANGA Palmitoyltransferase SWF1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SWF1 PE=3 SV=1 87 153 3.0E-10
sp|Q5R838|ZDHC5_PONAB Palmitoyltransferase ZDHHC5 OS=Pongo abelii GN=ZDHHC5 PE=2 SV=1 78 199 4.0E-10
sp|Q7S3M5|AKR1_NEUCR Palmitoyltransferase akr1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ptr-1 PE=3 SV=2 56 141 4.0E-10
sp|Q54VH7|ZDHC8_DICDI Putative ZDHHC-type palmitoyltransferase 8 OS=Dictyostelium discoideum GN=DDB_G0280329 PE=2 SV=1 83 160 4.0E-10
sp|Q2THW9|ZDHC5_CANLF Palmitoyltransferase ZDHHC5 OS=Canis lupus familiaris GN=ZDHHC5 PE=2 SV=1 78 201 5.0E-10
sp|Q5Y5T5|ZDHC8_MOUSE Probable palmitoyltransferase ZDHHC8 OS=Mus musculus GN=Zdhhc8 PE=1 SV=1 85 201 5.0E-10
sp|Q80TN5|ZDH17_MOUSE Palmitoyltransferase ZDHHC17 OS=Mus musculus GN=Zdhhc17 PE=1 SV=2 86 144 5.0E-10
sp|B3DN87|ZDH12_ARATH Probable protein S-acyltransferase 1 OS=Arabidopsis thaliana GN=PAT01 PE=2 SV=1 85 216 5.0E-10
sp|Q6IR37|ZDH24_MOUSE Probable palmitoyltransferase ZDHHC24 OS=Mus musculus GN=Zdhhc24 PE=2 SV=2 86 279 6.0E-10
sp|E9PTT0|ZDH17_RAT Palmitoyltransferase ZDHHC17 OS=Rattus norvegicus GN=Zdhhc17 PE=1 SV=1 86 144 6.0E-10
sp|Q4WWN2|ERFB_ASPFU Palmitoyltransferase erf2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=erf2 PE=3 SV=1 6 148 6.0E-10
sp|Q6CJC5|SWF1_KLULA Palmitoyltransferase SWF1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SWF1 PE=3 SV=1 87 147 7.0E-10
sp|Q2THW8|ZDHC8_CANLF Probable palmitoyltransferase ZDHHC8 OS=Canis lupus familiaris GN=ZDHHC8 PE=2 SV=1 85 203 8.0E-10
sp|Q8IUH5|ZDH17_HUMAN Palmitoyltransferase ZDHHC17 OS=Homo sapiens GN=ZDHHC17 PE=1 SV=2 86 144 8.0E-10
sp|Q5PNZ1|ZDH21_ARATH Probable protein S-acyltransferase 3 OS=Arabidopsis thaliana GN=PAT03 PE=2 SV=1 12 134 8.0E-10
sp|Q8BQQ1|ZDH14_MOUSE Probable palmitoyltransferase ZDHHC14 OS=Mus musculus GN=Zdhhc14 PE=1 SV=1 42 228 9.0E-10
sp|E1BLT8|ZDHC5_BOVIN Palmitoyltransferase ZDHHC5 OS=Bos taurus GN=ZDHHC5 PE=3 SV=1 17 201 1.0E-09
sp|Q2THX0|ZDHC8_PANTR Probable palmitoyltransferase ZDHHC8 OS=Pan troglodytes GN=ZDHHC8 PE=2 SV=1 85 203 1.0E-09
sp|Q9ULC8|ZDHC8_HUMAN Probable palmitoyltransferase ZDHHC8 OS=Homo sapiens GN=ZDHHC8 PE=1 SV=3 85 203 1.0E-09
sp|Q4I1J3|PFA5_GIBZE Palmitoyltransferase PFA5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PFA5 PE=3 SV=1 79 136 1.0E-09
sp|Q0VC89|ZDH20_BOVIN Probable palmitoyltransferase ZDHHC20 OS=Bos taurus GN=ZDHHC20 PE=2 SV=1 86 127 2.0E-09
sp|A2VDT6|ZDH21_BOVIN Probable palmitoyltransferase ZDHHC21 OS=Bos taurus GN=ZDHHC21 PE=2 SV=1 21 139 2.0E-09
sp|Q8IZN3|ZDH14_HUMAN Probable palmitoyltransferase ZDHHC14 OS=Homo sapiens GN=ZDHHC14 PE=1 SV=1 42 228 2.0E-09
sp|Q9M306|ZDH10_ARATH Probable protein S-acyltransferase 5 OS=Arabidopsis thaliana GN=PAT05 PE=1 SV=2 86 221 2.0E-09
sp|Q8T2Q0|ZDHC6_DICDI Putative ZDHHC-type palmitoyltransferase 6 OS=Dictyostelium discoideum GN=DDB_G0275149 PE=2 SV=1 59 189 2.0E-09
sp|Q9D270|ZDH21_MOUSE Probable palmitoyltransferase ZDHHC21 OS=Mus musculus GN=Zdhhc21 PE=1 SV=2 67 139 2.0E-09
sp|Q8WVZ1|ZDH19_HUMAN Probable palmitoyltransferase ZDHHC19 OS=Homo sapiens GN=ZDHHC19 PE=2 SV=2 86 249 3.0E-09
sp|Q6C4W5|PFA3_YARLI Palmitoyltransferase PFA3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PFA3 PE=3 SV=1 33 350 3.0E-09
sp|Q0WQK2|ZDHC9_ARATH Probable protein S-acyltransferase 7 OS=Arabidopsis thaliana GN=PAT07 PE=1 SV=1 76 160 3.0E-09
sp|P42836|PFA3_YEAST Palmitoyltransferase PFA3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFA3 PE=1 SV=1 70 152 3.0E-09
sp|Q5RB84|ZDH21_PONAB Probable palmitoyltransferase ZDHHC21 OS=Pongo abelii GN=ZDHHC21 PE=2 SV=1 43 139 3.0E-09
sp|Q8IVQ6|ZDH21_HUMAN Palmitoyltransferase ZDHHC21 OS=Homo sapiens GN=ZDHHC21 PE=2 SV=1 43 139 3.0E-09
sp|Q3EC11|ZDHC2_ARATH Probable protein S-acyltransferase 23 OS=Arabidopsis thaliana GN=PAT23 PE=2 SV=2 84 160 4.0E-09
sp|Q5B3W7|ERFB_EMENI Palmitoyltransferase erf2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=erf2 PE=3 SV=2 86 148 4.0E-09
sp|Q9FLM3|ZDH23_ARATH Probable protein S-acyltransferase 6 OS=Arabidopsis thaliana GN=PAT06 PE=2 SV=1 76 231 5.0E-09
sp|P59268|ZDHC9_MOUSE Palmitoyltransferase ZDHHC9 OS=Mus musculus GN=Zdhhc9 PE=2 SV=1 85 135 6.0E-09
sp|Q6CQB5|ERFB_KLULA Palmitoyltransferase ERF2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ERF2 PE=3 SV=1 81 165 7.0E-09
sp|Q58DA8|ZDHC9_BOVIN Palmitoyltransferase ZDHHC9 OS=Bos taurus GN=ZDHHC9 PE=2 SV=1 85 135 7.0E-09
sp|Q5R5J8|ZDHC9_PONAB Palmitoyltransferase ZDHHC9 OS=Pongo abelii GN=ZDHHC9 PE=2 SV=1 86 135 7.0E-09
sp|Q9Y397|ZDHC9_HUMAN Palmitoyltransferase ZDHHC9 OS=Homo sapiens GN=ZDHHC9 PE=1 SV=2 86 135 7.0E-09
sp|Q2TGI5|ZDH24_RAT Probable palmitoyltransferase ZDHHC24 OS=Rattus norvegicus GN=Zdhhc24 PE=2 SV=1 86 279 8.0E-09
sp|Q76IC6|ZDH23_RAT Palmitoyltransferase ZDHHC23 OS=Rattus norvegicus GN=Zdhhc23 PE=1 SV=2 85 150 9.0E-09
sp|Q5Y5T3|ZDH23_MOUSE Palmitoyltransferase ZDHHC23 OS=Mus musculus GN=Zdhhc23 PE=2 SV=1 81 150 9.0E-09
sp|Q9M1K5|ZDH13_ARATH Probable protein S-acyltransferase 4 OS=Arabidopsis thaliana GN=PAT04 PE=2 SV=1 86 254 9.0E-09
sp|Q74ZZ2|SWF1_ASHGO Palmitoyltransferase SWF1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SWF1 PE=3 SV=1 83 130 1.0E-08
sp|Q9SB58|ZDH19_ARATH Protein S-acyltransferase 8 OS=Arabidopsis thaliana GN=PAT08 PE=1 SV=2 70 134 2.0E-08
sp|Q04629|SWF1_YEAST Palmitoyltransferase SWF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWF1 PE=1 SV=2 87 145 2.0E-08
sp|Q8IYP9|ZDH23_HUMAN Palmitoyltransferase ZDHHC23 OS=Homo sapiens GN=ZDHHC23 PE=1 SV=3 80 122 3.0E-08
sp|Q5FVR1|ZDHC4_RAT Probable palmitoyltransferase ZDHHC4 OS=Rattus norvegicus GN=Zdhhc4 PE=2 SV=1 13 140 6.0E-08
sp|Q52T38|ZDH22_ARATH Protein S-acyltransferase 24 OS=Arabidopsis thaliana GN=PAT24 PE=2 SV=1 82 122 6.0E-08
sp|Q5BC23|SWF1_EMENI Palmitoyltransferase swf1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=swf1 PE=3 SV=1 77 130 7.0E-08
sp|Q2TGJ1|ZDH18_RAT Palmitoyltransferase ZDHHC18 OS=Rattus norvegicus GN=Zdhhc18 PE=2 SV=1 42 201 9.0E-08
sp|Q6FSS4|ERFB_CANGA Palmitoyltransferase ERF2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ERF2 PE=3 SV=1 85 140 1.0E-07
sp|Q9NUE0|ZDH18_HUMAN Palmitoyltransferase ZDHHC18 OS=Homo sapiens GN=ZDHHC18 PE=2 SV=2 42 135 2.0E-07
sp|Q6BHT4|ERFB_DEBHA Palmitoyltransferase ERF2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ERF2 PE=3 SV=2 77 137 2.0E-07
sp|O74384|ERFB_SCHPO Palmitoyltransferase erf2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erf2 PE=1 SV=1 76 150 2.0E-07
sp|Q03289|PFA5_YEAST Palmitoyltransferase PFA5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFA5 PE=1 SV=1 86 282 2.0E-07
sp|Q5Y5T2|ZDH18_MOUSE Palmitoyltransferase ZDHHC18 OS=Mus musculus GN=Zdhhc18 PE=1 SV=4 42 201 2.0E-07
sp|Q6CRV3|PFA5_KLULA Palmitoyltransferase PFA5 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PFA5 PE=3 SV=1 86 213 3.0E-07
sp|Q557H5|ZDHC3_DICDI Putative ZDHHC-type palmitoyltransferase 3 OS=Dictyostelium discoideum GN=DDB_G0273477 PE=3 SV=1 86 163 3.0E-07
sp|Q9D6H5|ZDHC4_MOUSE Probable palmitoyltransferase ZDHHC4 OS=Mus musculus GN=Zdhhc4 PE=2 SV=1 87 135 3.0E-07
sp|Q9CWU2|ZDH13_MOUSE Palmitoyltransferase ZDHHC13 OS=Mus musculus GN=Zdhhc13 PE=1 SV=2 15 135 4.0E-07
sp|Q750R7|ERFB_ASHGO Palmitoyltransferase ERF2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ERF2 PE=3 SV=1 85 144 4.0E-07
sp|Q7RWM9|SWF1_NEUCR Palmitoyltransferase SWF1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=swf-1 PE=3 SV=1 55 139 6.0E-07
sp|Q58DT3|ZDHC4_BOVIN Probable palmitoyltransferase ZDHHC4 OS=Bos taurus GN=ZDHHC4 PE=2 SV=1 74 134 7.0E-07
sp|Q06551|ERFB_YEAST Palmitoyltransferase ERF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERF2 PE=1 SV=1 81 140 7.0E-07
sp|Q6C890|ERFB_YARLI Palmitoyltransferase ERF2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ERF2 PE=3 SV=2 85 169 8.0E-07
sp|Q5NVB9|ZDH13_PONAB Palmitoyltransferase ZDHHC13 OS=Pongo abelii GN=ZDHHC13 PE=2 SV=1 27 139 8.0E-07
sp|Q4R690|ZDH13_MACFA Palmitoyltransferase ZDHHC13 OS=Macaca fascicularis GN=ZDHHC13 PE=2 SV=1 27 139 1.0E-06
sp|Q4WN54|SWF1_ASPFU Palmitoyltransferase swf1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=swf1 PE=3 SV=1 77 130 2.0E-06
sp|Q8IUH4|ZDH13_HUMAN Palmitoyltransferase ZDHHC13 OS=Homo sapiens GN=ZDHHC13 PE=1 SV=3 27 139 2.0E-06
sp|Q9C533|ZDHC1_ARATH Probable protein S-acyltransferase 22 OS=Arabidopsis thaliana GN=PAT22 PE=2 SV=2 77 189 2.0E-06
sp|Q2TGI8|ZDH22_RAT Palmitoyltransferase ZDHHC22 OS=Rattus norvegicus GN=Zdhhc22 PE=2 SV=1 71 229 3.0E-06
sp|Q552M6|ZDHC7_DICDI Putative ZDHHC-type palmitoyltransferase 7 OS=Dictyostelium discoideum GN=DDB_G0276017 PE=2 SV=1 86 203 3.0E-06
sp|Q59QL0|ERFB_CANAL Palmitoyltransferase ERF2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ERF2 PE=3 SV=2 86 140 5.0E-06
sp|A0PK84|ZDH22_MOUSE Palmitoyltransferase ZDHHC22 OS=Mus musculus GN=Zdhhc22 PE=2 SV=1 71 229 6.0E-06
sp|Q8VYS8|ZDH24_ARATH Probable protein S-acyltransferase 9 OS=Arabidopsis thaliana GN=PAT09 PE=2 SV=1 61 139 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016409 palmitoyltransferase activity Yes
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0016746 acyltransferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 49 68 19
3 130 149 19
4 169 191 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7302
MAGLNSVPLIGNFAVPAVCLLIASLGYFSQFILHRCDLDPGPPSRTETVVFNSLLLCLWYCYFKTVLVDPGRYVL
REKVTELDGNWCRKCAAPKPPRAHHCRLCGRCIPKMDHHCPWTRNCVSMTTFPHFLRFLVYANVSLWALGRMLWT
RFHALWQVRHLPAYLGPSLGALIALATTSLVCFCTAFALGIMLITSIRTWLFNCTMIEGWELDRHEAVLDRRGRD
SWDMVLPDGDKVRFERVEFPYDIGFFSNMAQAMGTRNILLWLFPFSGNPKVADDGQGIGWTWEENGFNRREGMWP
PQDPDKVRRAAAPWHASRSQQEAQLQDEHLSPEQWQQAFRERQEQDEERKRLLLRELEELDDNDLGNTRDRHQHQ
PIAWINSDGERLHDYGVDEETEDVDAPASRAGGRDDDEDLPLAELLRRRRVVQENRVASLDERERETSRG*
Coding >Ophun1|7302
ATGGCTGGCCTCAATAGCGTGCCGTTGATTGGCAATTTCGCCGTTCCTGCTGTCTGTCTGTTGATCGCCTCTCTC
GGTTACTTCTCCCAGTTCATCTTGCACCGTTGCGATCTCGACCCCGGGCCCCCTTCTCGAACCGAAACGGTCGTC
TTCAACAGCTTACTCCTCTGTCTATGGTATTGCTACTTCAAAACCGTCCTGGTCGATCCCGGGCGCTATGTTCTT
CGCGAAAAGGTGACGGAGCTCGACGGCAACTGGTGCAGGAAATGTGCAGCTCCGAAGCCACCCAGGGCCCATCAT
TGCCGGCTCTGCGGCCGATGCATACCTAAAATGGACCATCACTGCCCCTGGACTCGGAACTGCGTGTCCATGACG
ACCTTTCCGCATTTCCTGCGCTTCCTCGTGTACGCCAATGTGTCGTTGTGGGCGCTGGGGAGGATGCTTTGGACG
CGATTTCATGCCCTTTGGCAGGTCCGACACTTGCCTGCCTACCTAGGACCTAGCCTTGGCGCTCTCATCGCCTTA
GCAACAACTTCTCTCGTCTGCTTCTGCACTGCATTTGCCCTCGGCATCATGCTTATCACCTCGATAAGGACCTGG
CTGTTCAACTGCACAATGATCGAGGGCTGGGAGCTGGACAGGCACGAGGCCGTCCTGGATCGACGCGGGCGAGAC
TCGTGGGATATGGTTCTCCCAGATGGGGACAAAGTCCGGTTTGAGAGAGTCGAGTTCCCCTACGACATTGGCTTC
TTTTCCAACATGGCTCAAGCCATGGGGACTCGCAATATCCTCCTCTGGCTCTTCCCCTTTTCCGGCAACCCCAAA
GTCGCTGATGACGGCCAAGGCATCGGCTGGACGTGGGAGGAGAATGGCTTCAACCGCAGGGAAGGGATGTGGCCG
CCTCAAGATCCCGATAAGGTTCGACGGGCTGCGGCACCATGGCACGCTTCTCGTTCACAACAGGAAGCACAACTT
CAAGACGAGCATCTCAGCCCTGAGCAATGGCAGCAGGCCTTCCGGGAACGCCAGGAACAGGACGAGGAGCGAAAA
CGTCTGCTTCTCCGGGAGCTGGAGGAATTGGACGACAATGACCTCGGTAACACCCGAGATCGACACCAGCATCAG
CCGATTGCTTGGATCAACTCAGACGGCGAGCGACTTCACGACTATGGCGTAGACGAGGAAACTGAAGATGTCGAT
GCTCCCGCCTCGCGTGCAGGCGGGCGCGACGATGACGAGGACCTACCCCTCGCCGAGTTGCTCCGCCGGAGACGA
GTTGTTCAAGAGAATCGAGTTGCCTCATTGGACGAGCGGGAGCGGGAAACCTCTCGTGGATGA
Transcript >Ophun1|7302
ATGGCTGGCCTCAATAGCGTGCCGTTGATTGGCAATTTCGCCGTTCCTGCTGTCTGTCTGTTGATCGCCTCTCTC
GGTTACTTCTCCCAGTTCATCTTGCACCGTTGCGATCTCGACCCCGGGCCCCCTTCTCGAACCGAAACGGTCGTC
TTCAACAGCTTACTCCTCTGTCTATGGTATTGCTACTTCAAAACCGTCCTGGTCGATCCCGGGCGCTATGTTCTT
CGCGAAAAGGTGACGGAGCTCGACGGCAACTGGTGCAGGAAATGTGCAGCTCCGAAGCCACCCAGGGCCCATCAT
TGCCGGCTCTGCGGCCGATGCATACCTAAAATGGACCATCACTGCCCCTGGACTCGGAACTGCGTGTCCATGACG
ACCTTTCCGCATTTCCTGCGCTTCCTCGTGTACGCCAATGTGTCGTTGTGGGCGCTGGGGAGGATGCTTTGGACG
CGATTTCATGCCCTTTGGCAGGTCCGACACTTGCCTGCCTACCTAGGACCTAGCCTTGGCGCTCTCATCGCCTTA
GCAACAACTTCTCTCGTCTGCTTCTGCACTGCATTTGCCCTCGGCATCATGCTTATCACCTCGATAAGGACCTGG
CTGTTCAACTGCACAATGATCGAGGGCTGGGAGCTGGACAGGCACGAGGCCGTCCTGGATCGACGCGGGCGAGAC
TCGTGGGATATGGTTCTCCCAGATGGGGACAAAGTCCGGTTTGAGAGAGTCGAGTTCCCCTACGACATTGGCTTC
TTTTCCAACATGGCTCAAGCCATGGGGACTCGCAATATCCTCCTCTGGCTCTTCCCCTTTTCCGGCAACCCCAAA
GTCGCTGATGACGGCCAAGGCATCGGCTGGACGTGGGAGGAGAATGGCTTCAACCGCAGGGAAGGGATGTGGCCG
CCTCAAGATCCCGATAAGGTTCGACGGGCTGCGGCACCATGGCACGCTTCTCGTTCACAACAGGAAGCACAACTT
CAAGACGAGCATCTCAGCCCTGAGCAATGGCAGCAGGCCTTCCGGGAACGCCAGGAACAGGACGAGGAGCGAAAA
CGTCTGCTTCTCCGGGAGCTGGAGGAATTGGACGACAATGACCTCGGTAACACCCGAGATCGACACCAGCATCAG
CCGATTGCTTGGATCAACTCAGACGGCGAGCGACTTCACGACTATGGCGTAGACGAGGAAACTGAAGATGTCGAT
GCTCCCGCCTCGCGTGCAGGCGGGCGCGACGATGACGAGGACCTACCCCTCGCCGAGTTGCTCCGCCGGAGACGA
GTTGTTCAAGAGAATCGAGTTGCCTCATTGGACGAGCGGGAGCGGGAAACCTCTCGTGGATGA
Gene >Ophun1|7302
ATGGCTGGCCTCAATAGCGTGCCGTTGATTGGCAATTTCGCCGTTCCTGCTGTCTGTCTGTTGATCGCCTCTCTC
GGTTACTTCTCCCAGTTCATCTTGCACCGTTGCGATCTCGACCCCGGGCCCCCTTCTCGAACCGAAACGGTCGTC
TTCAACAGCTTACTCCTCTGTCTATGGTATTGCTACTTCAAAACCGTCCTGGTCGATCCCGGGCGCTATGTTCTT
CGCGAAAAGGTGACGGAGCTCGACGGCAACTGGTGCAGGAAATGTGCAGCTCCGAAGCCACCCAGGGCCCATCAT
TGCCGGCTCTGCGGCCGATGCATACCTAAAATGGACCATCACTGCCCCTGGACTCGGAACTGCGTGTCCATGACG
ACCTTTCCGCATTTCCTGCGCTTCCTCGTGTACGCCAATGTGTCGTTGTGGGCGCTGGGGAGGATGCTTTGGACG
CGATTTCATGCCCTTTGGCAGGTCCGACACTTGCCTGCCTACCTAGGACCTAGCCTTGGCGCTCTCATCGCCTTA
GCAACAACTTCTCTCGTCTGCTTCTGCACTGCATTTGCCCTCGGCATCATGCTTATCACCTCGATAAGGACCTGG
CTGTTCAACTGCACAATGATCGAGGGCTGGGAGCTGGACAGGCACGAGGCCGTCCTGGATCGACGCGGGCGAGAC
TCGTGGGATATGGTTCTCCCAGATGGGGACAAAGTCCGGTTTGAGAGAGTCGAGTTCCCCTACGACATTGGCTTC
TTTTCCAACATGGCTCAAGCCATGGGGACTCGCAATATCCTCCTCTGGCTCTTCCCCTTTTCCGGCAACCCCAAA
GTCGCTGATGACGGCCAAGGCATCGGCTGGACGTGGGAGGAGAATGGCTTCAACCGCAGGGAAGGGATGTGGCCG
CCTCAAGATCCCGATAAGGTTCGACGGGCTGCGGCACCATGGCACGCTTCTCGTTCACAACAGGAAGCACAACTT
CAAGACGAGCATCTCAGCCCTGAGCAATGGCAGCAGGCCTTCCGGGAACGCCAGGAACAGGACGAGGAGCGAAAA
CGTCTGCTTCTCCGGGAGCTGGAGGAATTGGACGACAATGACCTCGGTAACACCCGAGATCGACACCAGCATCAG
CCGATTGCTTGGATCAACTCAGACGGCGAGCGACTTCACGACTATGGCGTAGACGAGGAAACTGAAGATGTCGAT
GCTCCCGCCTCGCGTGCAGGCGGGCGCGACGATGACGAGGACCTACCCCTCGCCGAGTTGCTCCGCCGGAGACGA
GTTGTTCAAGAGAATCGAGTTGCCTCATTGGACGAGCGGGAGCGGGAAACCTCTCGTGGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail