Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7296
Gene name
LocationContig_9:23388..24258
Strand-
Gene length (bp)870
Transcript length (bp)516
Coding sequence length (bp)516
Protein length (aa) 172

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02936 COX4 Cytochrome c oxidase subunit IV 3.0E-50 30 166

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P06810|COX5_NEUCR Cytochrome c oxidase polypeptide 5, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cya-4 PE=3 SV=2 1 167 2.0E-66
sp|O93980|COX5_ASPNG Cytochrome c oxidase polypeptide 5, mitochondrial OS=Aspergillus niger GN=cox5 PE=3 SV=1 25 168 3.0E-60
sp|O74988|COX5_SCHPO Cytochrome c oxidase polypeptide 5, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cox5 PE=3 SV=2 14 164 6.0E-35
sp|P00425|COX5B_YEAST Cytochrome c oxidase polypeptide 5B, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX5B PE=1 SV=3 25 154 9.0E-21
sp|P00424|COX5A_YEAST Cytochrome c oxidase polypeptide 5A, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX5A PE=1 SV=1 26 154 4.0E-20

GO

GO Term Description Terminal node
GO:0005751 mitochondrial respiratory chain complex IV Yes
GO:0006123 mitochondrial electron transport, cytochrome c to oxygen Yes
GO:0032991 protein-containing complex No
GO:0044237 cellular metabolic process No
GO:0019646 aerobic electron transport chain No
GO:0009987 cellular process No
GO:0009060 aerobic respiration No
GO:0008152 metabolic process No
GO:0045333 cellular respiration No
GO:0098798 mitochondrial protein-containing complex No
GO:0006091 generation of precursor metabolites and energy No
GO:0098796 membrane protein complex No
GO:0015980 energy derivation by oxidation of organic compounds No
GO:0022900 electron transport chain No
GO:0045277 respiratory chain complex IV No
GO:0022904 respiratory electron transport chain No
GO:0070069 cytochrome complex No
GO:0005575 cellular_component No
GO:0098800 inner mitochondrial membrane protein complex No
GO:0098803 respiratory chain complex No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

Domain # Start End Length
1 101 123 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7296
MFRLRPSGLFRKRLALSCPVSSFISRASSTHAISKPTLANIEKRWETMPLQEQADLWMALRDRMKGDWNELTIQE
KKAAYWIAFGPHGPRAEDPPGYNAEVAWLVAKGFAVSLVLFAIIRYFAKPEPHTMSREYQEATNEMLKRQKADPI
TGISSEGYTGRGQIQSPPKGH*
Coding >Ophun1|7296
ATGTTTCGCCTCCGGCCATCCGGTCTCTTCCGCAAGAGACTGGCGCTTAGCTGCCCCGTCTCGTCGTTCATCTCC
CGCGCTTCGTCCACCCACGCCATCTCCAAACCGACGCTGGCCAACATCGAGAAGCGATGGGAGACAATGCCCCTC
CAAGAGCAGGCTGATCTTTGGATGGCCTTGCGAGATCGCATGAAGGGCGATTGGAACGAGTTGACGATCCAAGAG
AAAAAGGCTGCTTACTGGATTGCTTTCGGTCCCCACGGGCCTCGCGCTGAGGACCCCCCCGGCTACAATGCTGAA
GTTGCCTGGCTTGTTGCGAAAGGTTTCGCCGTCAGCCTGGTTCTCTTTGCCATCATCCGGTACTTTGCGAAGCCC
GAGCCCCATACCATGTCCAGAGAGTACCAGGAGGCAACCAATGAGATGCTCAAGAGACAAAAAGCCGATCCAATC
ACCGGCATCTCGTCTGAGGGCTACACTGGCAGGGGTCAAATCCAGTCTCCCCCAAAGGGCCACTGA
Transcript >Ophun1|7296
ATGTTTCGCCTCCGGCCATCCGGTCTCTTCCGCAAGAGACTGGCGCTTAGCTGCCCCGTCTCGTCGTTCATCTCC
CGCGCTTCGTCCACCCACGCCATCTCCAAACCGACGCTGGCCAACATCGAGAAGCGATGGGAGACAATGCCCCTC
CAAGAGCAGGCTGATCTTTGGATGGCCTTGCGAGATCGCATGAAGGGCGATTGGAACGAGTTGACGATCCAAGAG
AAAAAGGCTGCTTACTGGATTGCTTTCGGTCCCCACGGGCCTCGCGCTGAGGACCCCCCCGGCTACAATGCTGAA
GTTGCCTGGCTTGTTGCGAAAGGTTTCGCCGTCAGCCTGGTTCTCTTTGCCATCATCCGGTACTTTGCGAAGCCC
GAGCCCCATACCATGTCCAGAGAGTACCAGGAGGCAACCAATGAGATGCTCAAGAGACAAAAAGCCGATCCAATC
ACCGGCATCTCGTCTGAGGGCTACACTGGCAGGGGTCAAATCCAGTCTCCCCCAAAGGGCCACTGA
Gene >Ophun1|7296
ATGTTTCGCCTCCGGCCATCCGGTCTCTTCCGCAAGAGACTGGCGCTTAGCTGCCCCGTCTCGTCGTTCATCTCC
CGCGCTTCGTCCACCCACGCCATCTCCAAACCGACGCTGGCCAACATCGAGAAGCGATGGGAGACAATGCCCCTC
CAAGAGCAGGCTGATCTTTGGATGGCCTTGCGAGATCGCATGAAGGGCGATTGGAACGAGTTGACGATCCAAGAG
AAAAAGGCTGGTGCGTGCAGAGTTCCGCCTCTTTCTTCCTTTTGGGAAATGCCTCTGCCTAGTTATCCCCGACCT
TCGGGCGAGATAACCCCTCCAAGCGCGGAACCCGAGTCTTGCACCCCAATACTCGTTCTATATTTCCATTCCCCT
TTTTCACTGCCTTCGAGATGTGGCTTCTCGTGTTTCGACGATGGTCTCGTCAAGGATCTCCGGGGCTGCCTCCGT
ATTCCACCAAGCAGCTGCTTCAATGCTTGACAGAAGCTGTCGAAACCGCTGACGATTCCTTTCAAACAGCTTACT
GGATTGCTTTCGGTCCCCACGGGCCTCGCGCTGAGGACCCCCCCGGCTACAATGCTGAAGTTGCCTGGCTTGTTG
CGAAAGGTTTCGCCGTCAGCCTGGTTCTCTTTGCCATCATCCGGTACTTTGCGAAGCCCGAGCCCCATACCATGT
CCAGAGAGTACCAGGAGGCAACCAATGAGATGCTCAAGGTACGCTCCGAGTCCATTGCTTTAGACTGACGACAGG
TAATTCGATGGTGACTGACACATTCAACTGCAGAGACAAAAAGCCGATCCAATCACCGGCATCTCGTCTGAGGGC
TACACTGGCAGGGGTCAAATCCAGTCTCCCCCAAAGGGCCACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail