Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7289
Gene name
LocationContig_9:244..2089
Strand-
Gene length (bp)1845
Transcript length (bp)1845
Coding sequence length (bp)1845
Protein length (aa) 615

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01490 Aa_trans Transmembrane amino acid transporter protein 1.3E-76 222 607

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10074|AVT3_SCHPO Vacuolar amino acid transporter 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=avt3 PE=1 SV=1 29 608 2.0E-122
sp|P36062|AVT3_YEAST Vacuolar amino acid transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT3 PE=1 SV=1 60 611 2.0E-121
sp|P50944|AVT4_YEAST Vacuolar amino acid transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT4 PE=1 SV=1 44 608 3.0E-97
sp|Q4KL91|S36A4_XENLA Proton-coupled amino acid transporter 4 OS=Xenopus laevis GN=slc36a4 PE=2 SV=1 196 612 3.0E-36
sp|Q7Z2H8|S36A1_HUMAN Proton-coupled amino acid transporter 1 OS=Homo sapiens GN=SLC36A1 PE=1 SV=1 179 613 6.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10074|AVT3_SCHPO Vacuolar amino acid transporter 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=avt3 PE=1 SV=1 29 608 2.0E-122
sp|P36062|AVT3_YEAST Vacuolar amino acid transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT3 PE=1 SV=1 60 611 2.0E-121
sp|P50944|AVT4_YEAST Vacuolar amino acid transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT4 PE=1 SV=1 44 608 3.0E-97
sp|Q4KL91|S36A4_XENLA Proton-coupled amino acid transporter 4 OS=Xenopus laevis GN=slc36a4 PE=2 SV=1 196 612 3.0E-36
sp|Q7Z2H8|S36A1_HUMAN Proton-coupled amino acid transporter 1 OS=Homo sapiens GN=SLC36A1 PE=1 SV=1 179 613 6.0E-34
sp|Q8CH36|S36A4_MOUSE Proton-coupled amino acid transporter 4 OS=Mus musculus GN=Slc36a4 PE=2 SV=1 186 610 1.0E-29
sp|Q8K4D3|S36A1_MOUSE Proton-coupled amino acid transporter 1 OS=Mus musculus GN=Slc36a1 PE=2 SV=1 179 613 1.0E-28
sp|Q6YBV0|S36A4_HUMAN Proton-coupled amino acid transporter 4 OS=Homo sapiens GN=SLC36A4 PE=1 SV=1 186 610 1.0E-28
sp|Q8BHK3|S36A2_MOUSE Proton-coupled amino acid transporter 2 OS=Mus musculus GN=Slc36a2 PE=1 SV=1 226 614 1.0E-28
sp|Q924A5|S36A1_RAT Proton-coupled amino acid transporter 1 OS=Rattus norvegicus GN=Slc36a1 PE=2 SV=1 179 613 3.0E-28
sp|Q9SF09|ANT1_ARATH Amino acid transporter ANT1 OS=Arabidopsis thaliana GN=ANT1 PE=1 SV=1 189 608 1.0E-27
sp|F4ILY9|ANTL1_ARATH Amino acid transporter ANTL1 OS=Arabidopsis thaliana GN=At2g42005 PE=2 SV=1 222 610 5.0E-26
sp|Q8K415|S36A2_RAT Proton-coupled amino acid transporter 2 OS=Rattus norvegicus GN=Slc36a2 PE=1 SV=1 226 508 5.0E-26
sp|Q495M3|S36A2_HUMAN Proton-coupled amino acid transporter 2 OS=Homo sapiens GN=SLC36A2 PE=1 SV=1 178 614 1.0E-25
sp|Q9FKY3|ANTL3_ARATH Amino acid transporter ANTL3 OS=Arabidopsis thaliana GN=At5g65990 PE=2 SV=1 206 614 2.0E-24
sp|Q495N2|S36A3_HUMAN Proton-coupled amino acid transporter 3 OS=Homo sapiens GN=SLC36A3 PE=2 SV=2 219 610 2.0E-24
sp|Q4V8B1|S36A3_RAT Proton-coupled amino acid transporter 3 OS=Rattus norvegicus GN=Slc36a3 PE=2 SV=1 214 610 1.0E-23
sp|Q9SVG0|ANTL2_ARATH Amino acid transporter ANTL2 OS=Arabidopsis thaliana GN=At4g38250 PE=1 SV=1 222 610 2.0E-23
sp|Q811P0|S36A3_MOUSE Proton-coupled amino acid transporter 3 OS=Mus musculus GN=Slc36a3 PE=2 SV=1 218 610 4.0E-22
sp|Q9JHZ9|S38A3_RAT Sodium-coupled neutral amino acid transporter 3 OS=Rattus norvegicus GN=Slc38a3 PE=2 SV=1 220 613 2.0E-13
sp|Q99624|S38A3_HUMAN Sodium-coupled neutral amino acid transporter 3 OS=Homo sapiens GN=SLC38A3 PE=1 SV=1 220 611 4.0E-12
sp|Q9DCP2|S38A3_MOUSE Sodium-coupled neutral amino acid transporter 3 OS=Mus musculus GN=Slc38a3 PE=1 SV=1 220 613 8.0E-12
sp|Q5SPB1|S38A2_DANRE Sodium-coupled neutral amino acid transporter 2 OS=Danio rerio GN=slc38a2 PE=3 SV=1 179 614 4.0E-11
sp|Q503G8|S38A6_DANRE Probable sodium-coupled neutral amino acid transporter 6 OS=Danio rerio GN=slc38a6 PE=2 SV=1 183 577 9.0E-11
sp|Q8WUX1|S38A5_HUMAN Sodium-coupled neutral amino acid transporter 5 OS=Homo sapiens GN=SLC38A5 PE=1 SV=1 181 613 5.0E-10
sp|G3UVW3|S38A6_MOUSE Probable sodium-coupled neutral amino acid transporter 6 OS=Mus musculus GN=Slc38a6 PE=2 SV=1 184 613 1.0E-09
sp|Q6DEL1|S38A7_DANRE Putative sodium-coupled neutral amino acid transporter 7 OS=Danio rerio GN=slc38a7 PE=2 SV=1 184 614 3.0E-09
sp|Q9JM15|S38A1_RAT Sodium-coupled neutral amino acid transporter 1 OS=Rattus norvegicus GN=Slc38a1 PE=1 SV=1 189 506 7.0E-09
sp|Q8K2P7|S38A1_MOUSE Sodium-coupled neutral amino acid transporter 1 OS=Mus musculus GN=Slc38a1 PE=1 SV=1 189 506 8.0E-09
sp|Q6PF45|VIAAT_XENLA Vesicular inhibitory amino acid transporter OS=Xenopus laevis GN=slc32a1 PE=2 SV=1 229 601 2.0E-08
sp|Q6DIV6|VIAAT_XENTR Vesicular inhibitory amino acid transporter OS=Xenopus tropicalis GN=slc32a1 PE=2 SV=1 229 601 2.0E-08
sp|P47082|AVT1_YEAST Vacuolar amino acid transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT1 PE=1 SV=1 109 586 2.0E-08
sp|Q6WWW3|S38A6_RAT Probable sodium-coupled neutral amino acid transporter 6 OS=Rattus norvegicus GN=Slc38a6 PE=2 SV=1 206 613 2.0E-08
sp|P34479|SKAT1_CAEEL Probable amino acid transporter skat-1 OS=Caenorhabditis elegans GN=skat-1 PE=2 SV=2 184 491 3.0E-08
sp|Q3U1J0|S38A5_MOUSE Sodium-coupled neutral amino acid transporter 5 OS=Mus musculus GN=Slc38a5 PE=1 SV=1 204 611 7.0E-08
sp|Q5E9S9|S38A5_BOVIN Sodium-coupled neutral amino acid transporter 5 OS=Bos taurus GN=SLC38A5 PE=2 SV=1 179 613 1.0E-07
sp|Q5R443|S38A1_PONAB Sodium-coupled neutral amino acid transporter 1 OS=Pongo abelii GN=SLC38A1 PE=2 SV=1 189 577 2.0E-07
sp|D3Z813|S38AB_RAT Putative sodium-coupled neutral amino acid transporter 11 OS=Rattus norvegicus GN=Slc38a11 PE=2 SV=1 216 601 3.0E-07
sp|Q8IZM9|S38A6_HUMAN Probable sodium-coupled neutral amino acid transporter 6 OS=Homo sapiens GN=SLC38A6 PE=1 SV=2 206 613 4.0E-07
sp|Q9H2H9|S38A1_HUMAN Sodium-coupled neutral amino acid transporter 1 OS=Homo sapiens GN=SLC38A1 PE=1 SV=1 189 577 5.0E-07
sp|Q28HE5|S38A6_XENTR Probable sodium-coupled neutral amino acid transporter 6 OS=Xenopus tropicalis GN=slc38a6 PE=2 SV=1 186 577 7.0E-07
sp|Q3USY0|S38AB_MOUSE Putative sodium-coupled neutral amino acid transporter 11 OS=Mus musculus GN=Slc38a11 PE=2 SV=2 216 601 3.0E-06
sp|A2VCW5|S38A5_RAT Sodium-coupled neutral amino acid transporter 5 OS=Rattus norvegicus GN=Slc38a5 PE=1 SV=1 220 613 6.0E-06
sp|Q8R1S9|S38A4_MOUSE Sodium-coupled neutral amino acid transporter 4 OS=Mus musculus GN=Slc38a4 PE=1 SV=1 176 368 6.0E-06
sp|O35633|VIAAT_MOUSE Vesicular inhibitory amino acid transporter OS=Mus musculus GN=Slc32a1 PE=1 SV=3 229 575 6.0E-06
sp|Q5XH90|S38A2_XENTR Sodium-coupled neutral amino acid transporter 2 OS=Xenopus tropicalis GN=slc38a2 PE=2 SV=1 181 614 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

Domain # Start End Length
1 252 274 22
2 299 319 20
3 339 361 22
4 368 390 22
5 405 427 22
6 439 461 22
7 487 509 22
8 530 549 19
9 554 576 22
10 588 607 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7289
MVDNVDLSRSEQSKRQAAILDRFLPEGYSADAEVSLATNGVEQHANDSGPSSRFPSPSPVQPAVPESAAGVCVIA
DDPECATLSEALESSLRLQGGDMHRDMFKIKARANSLRRSATFSHQPSPRLQPADELSYPEQREPGGFRRQHLQH
RARQRRISGSYVVARNFVDFLDLYGSFAGEDLEDADSSDDGSATDDHSGTEAVRRPLLGHRHSRRHSRGGDASTL
KTFFTLLKAFIGTGIMFLPKAFLNGGILFSSLTLVVVSLINCLCFRLLLQCREKHGGGYGELGAAIIGPRFRRII
LTSIALSQLGFVCAGLIFTAENLAAFLQAVFGDHGRFDIGVHSLIAVQLIPLIPLVLIRNISKLGHVALLADVFI
LIGLVYIWYFDIWMLFRSGMDPTVRLFNPSAFTLTIGSAIFTFEGIGLILPIQTSMRKPEHFSGLLYMVMFLITI
IFTSIGALCYATFGEETKIQVISNFPQDSPVVNAVQLLYSLAVLGGEPVQLFPAVRIIETSIFGERATGKRSMAI
KWKKNGIRSAVMTLCIAISLVGATDLDKFVALIGSFACVPLVYIYPAYLHYRGVANTTWTRGLDLCVMLLGSVAM
VYTTFVTLKQWVNS*
Coding >Ophun1|7289
ATGGTTGATAATGTCGATTTGTCTAGGAGCGAGCAGAGCAAACGTCAAGCAGCCATCCTTGATCGCTTTCTGCCC
GAAGGCTACTCTGCGGATGCGGAAGTGAGCTTAGCTACCAATGGTGTCGAGCAGCACGCCAACGATTCCGGCCCG
AGTTCACGGTTTCCTTCGCCGTCTCCAGTCCAGCCTGCCGTCCCAGAATCAGCAGCCGGTGTCTGTGTTATCGCC
GATGACCCAGAGTGCGCTACGCTCTCTGAGGCCCTTGAGTCCTCCCTGCGGCTCCAGGGTGGAGACATGCACCGA
GATATGTTCAAGATCAAAGCTCGGGCTAACTCCCTTCGCCGTTCAGCCACTTTCTCCCATCAACCGTCACCTCGT
CTGCAGCCTGCTGATGAGTTGTCATATCCGGAGCAACGGGAACCTGGGGGCTTTCGTCGTCAACACCTGCAACAC
CGGGCCCGCCAGCGGCGCATTAGTGGCTCATATGTCGTGGCTAGAAACTTTGTTGATTTTCTCGACCTATACGGC
AGCTTCGCTGGAGAGGATCTCGAGGACGCAGATTCATCCGACGATGGATCGGCCACTGACGATCATTCCGGAACC
GAAGCTGTTCGACGGCCGCTACTTGGCCATAGACACTCAAGGCGGCACAGTCGGGGTGGCGACGCCAGCACTTTG
AAGACCTTCTTCACTCTCCTTAAGGCATTCATAGGCACAGGCATCATGTTTCTGCCGAAGGCTTTTCTCAACGGC
GGCATACTTTTTTCTTCTTTGACGTTGGTTGTCGTGTCGCTGATCAACTGCCTATGCTTTAGGCTGTTACTACAA
TGCCGTGAAAAGCATGGAGGAGGTTATGGAGAGCTCGGGGCAGCTATCATAGGTCCGCGGTTTCGCAGAATTATA
CTAACGTCTATAGCGCTTTCCCAATTGGGATTTGTCTGCGCTGGTCTTATTTTTACTGCGGAAAATCTCGCGGCG
TTCTTACAAGCTGTTTTTGGAGATCATGGAAGATTCGACATTGGAGTACACAGTCTCATTGCTGTTCAGCTCATA
CCACTCATCCCCTTAGTCCTGATCCGCAACATATCCAAGCTAGGCCACGTGGCCCTTCTAGCGGATGTATTCATC
TTGATCGGCTTGGTCTACATCTGGTACTTTGACATCTGGATGCTTTTCCGATCTGGGATGGACCCTACCGTGCGA
CTCTTTAACCCTTCCGCTTTCACCTTGACTATTGGATCAGCCATCTTTACCTTTGAGGGGATTGGTCTTATTTTA
CCCATACAAACAAGCATGCGAAAGCCGGAGCATTTCAGCGGCCTTTTGTATATGGTCATGTTCCTGATCACGATT
ATCTTCACCTCCATTGGCGCACTGTGCTATGCCACATTCGGAGAAGAAACCAAGATACAGGTTATCTCGAACTTC
CCTCAGGACTCCCCTGTTGTCAACGCCGTGCAACTCCTGTACTCACTGGCAGTTCTTGGAGGTGAACCCGTTCAA
CTTTTCCCCGCGGTCCGCATCATCGAAACATCGATATTCGGGGAACGAGCCACAGGCAAGAGAAGCATGGCCATC
AAATGGAAGAAGAACGGCATTCGATCAGCGGTGATGACATTATGTATCGCGATCAGTTTGGTTGGCGCGACAGAT
CTGGATAAGTTTGTCGCCTTGATTGGAAGCTTCGCGTGTGTTCCACTTGTGTACATCTACCCAGCGTATTTACAC
TACCGGGGTGTTGCAAACACAACTTGGACTAGAGGGCTAGATCTTTGTGTGATGCTGCTAGGTTCTGTTGCGATG
GTTTATACGACTTTTGTAACGTTAAAACAATGGGTCAACTCCTAG
Transcript >Ophun1|7289
ATGGTTGATAATGTCGATTTGTCTAGGAGCGAGCAGAGCAAACGTCAAGCAGCCATCCTTGATCGCTTTCTGCCC
GAAGGCTACTCTGCGGATGCGGAAGTGAGCTTAGCTACCAATGGTGTCGAGCAGCACGCCAACGATTCCGGCCCG
AGTTCACGGTTTCCTTCGCCGTCTCCAGTCCAGCCTGCCGTCCCAGAATCAGCAGCCGGTGTCTGTGTTATCGCC
GATGACCCAGAGTGCGCTACGCTCTCTGAGGCCCTTGAGTCCTCCCTGCGGCTCCAGGGTGGAGACATGCACCGA
GATATGTTCAAGATCAAAGCTCGGGCTAACTCCCTTCGCCGTTCAGCCACTTTCTCCCATCAACCGTCACCTCGT
CTGCAGCCTGCTGATGAGTTGTCATATCCGGAGCAACGGGAACCTGGGGGCTTTCGTCGTCAACACCTGCAACAC
CGGGCCCGCCAGCGGCGCATTAGTGGCTCATATGTCGTGGCTAGAAACTTTGTTGATTTTCTCGACCTATACGGC
AGCTTCGCTGGAGAGGATCTCGAGGACGCAGATTCATCCGACGATGGATCGGCCACTGACGATCATTCCGGAACC
GAAGCTGTTCGACGGCCGCTACTTGGCCATAGACACTCAAGGCGGCACAGTCGGGGTGGCGACGCCAGCACTTTG
AAGACCTTCTTCACTCTCCTTAAGGCATTCATAGGCACAGGCATCATGTTTCTGCCGAAGGCTTTTCTCAACGGC
GGCATACTTTTTTCTTCTTTGACGTTGGTTGTCGTGTCGCTGATCAACTGCCTATGCTTTAGGCTGTTACTACAA
TGCCGTGAAAAGCATGGAGGAGGTTATGGAGAGCTCGGGGCAGCTATCATAGGTCCGCGGTTTCGCAGAATTATA
CTAACGTCTATAGCGCTTTCCCAATTGGGATTTGTCTGCGCTGGTCTTATTTTTACTGCGGAAAATCTCGCGGCG
TTCTTACAAGCTGTTTTTGGAGATCATGGAAGATTCGACATTGGAGTACACAGTCTCATTGCTGTTCAGCTCATA
CCACTCATCCCCTTAGTCCTGATCCGCAACATATCCAAGCTAGGCCACGTGGCCCTTCTAGCGGATGTATTCATC
TTGATCGGCTTGGTCTACATCTGGTACTTTGACATCTGGATGCTTTTCCGATCTGGGATGGACCCTACCGTGCGA
CTCTTTAACCCTTCCGCTTTCACCTTGACTATTGGATCAGCCATCTTTACCTTTGAGGGGATTGGTCTTATTTTA
CCCATACAAACAAGCATGCGAAAGCCGGAGCATTTCAGCGGCCTTTTGTATATGGTCATGTTCCTGATCACGATT
ATCTTCACCTCCATTGGCGCACTGTGCTATGCCACATTCGGAGAAGAAACCAAGATACAGGTTATCTCGAACTTC
CCTCAGGACTCCCCTGTTGTCAACGCCGTGCAACTCCTGTACTCACTGGCAGTTCTTGGAGGTGAACCCGTTCAA
CTTTTCCCCGCGGTCCGCATCATCGAAACATCGATATTCGGGGAACGAGCCACAGGCAAGAGAAGCATGGCCATC
AAATGGAAGAAGAACGGCATTCGATCAGCGGTGATGACATTATGTATCGCGATCAGTTTGGTTGGCGCGACAGAT
CTGGATAAGTTTGTCGCCTTGATTGGAAGCTTCGCGTGTGTTCCACTTGTGTACATCTACCCAGCGTATTTACAC
TACCGGGGTGTTGCAAACACAACTTGGACTAGAGGGCTAGATCTTTGTGTGATGCTGCTAGGTTCTGTTGCGATG
GTTTATACGACTTTTGTAACGTTAAAACAATGGGTCAACTCCTAG
Gene >Ophun1|7289
ATGGTTGATAATGTCGATTTGTCTAGGAGCGAGCAGAGCAAACGTCAAGCAGCCATCCTTGATCGCTTTCTGCCC
GAAGGCTACTCTGCGGATGCGGAAGTGAGCTTAGCTACCAATGGTGTCGAGCAGCACGCCAACGATTCCGGCCCG
AGTTCACGGTTTCCTTCGCCGTCTCCAGTCCAGCCTGCCGTCCCAGAATCAGCAGCCGGTGTCTGTGTTATCGCC
GATGACCCAGAGTGCGCTACGCTCTCTGAGGCCCTTGAGTCCTCCCTGCGGCTCCAGGGTGGAGACATGCACCGA
GATATGTTCAAGATCAAAGCTCGGGCTAACTCCCTTCGCCGTTCAGCCACTTTCTCCCATCAACCGTCACCTCGT
CTGCAGCCTGCTGATGAGTTGTCATATCCGGAGCAACGGGAACCTGGGGGCTTTCGTCGTCAACACCTGCAACAC
CGGGCCCGCCAGCGGCGCATTAGTGGCTCATATGTCGTGGCTAGAAACTTTGTTGATTTTCTCGACCTATACGGC
AGCTTCGCTGGAGAGGATCTCGAGGACGCAGATTCATCCGACGATGGATCGGCCACTGACGATCATTCCGGAACC
GAAGCTGTTCGACGGCCGCTACTTGGCCATAGACACTCAAGGCGGCACAGTCGGGGTGGCGACGCCAGCACTTTG
AAGACCTTCTTCACTCTCCTTAAGGCATTCATAGGCACAGGCATCATGTTTCTGCCGAAGGCTTTTCTCAACGGC
GGCATACTTTTTTCTTCTTTGACGTTGGTTGTCGTGTCGCTGATCAACTGCCTATGCTTTAGGCTGTTACTACAA
TGCCGTGAAAAGCATGGAGGAGGTTATGGAGAGCTCGGGGCAGCTATCATAGGTCCGCGGTTTCGCAGAATTATA
CTAACGTCTATAGCGCTTTCCCAATTGGGATTTGTCTGCGCTGGTCTTATTTTTACTGCGGAAAATCTCGCGGCG
TTCTTACAAGCTGTTTTTGGAGATCATGGAAGATTCGACATTGGAGTACACAGTCTCATTGCTGTTCAGCTCATA
CCACTCATCCCCTTAGTCCTGATCCGCAACATATCCAAGCTAGGCCACGTGGCCCTTCTAGCGGATGTATTCATC
TTGATCGGCTTGGTCTACATCTGGTACTTTGACATCTGGATGCTTTTCCGATCTGGGATGGACCCTACCGTGCGA
CTCTTTAACCCTTCCGCTTTCACCTTGACTATTGGATCAGCCATCTTTACCTTTGAGGGGATTGGTCTTATTTTA
CCCATACAAACAAGCATGCGAAAGCCGGAGCATTTCAGCGGCCTTTTGTATATGGTCATGTTCCTGATCACGATT
ATCTTCACCTCCATTGGCGCACTGTGCTATGCCACATTCGGAGAAGAAACCAAGATACAGGTTATCTCGAACTTC
CCTCAGGACTCCCCTGTTGTCAACGCCGTGCAACTCCTGTACTCACTGGCAGTTCTTGGAGGTGAACCCGTTCAA
CTTTTCCCCGCGGTCCGCATCATCGAAACATCGATATTCGGGGAACGAGCCACAGGCAAGAGAAGCATGGCCATC
AAATGGAAGAAGAACGGCATTCGATCAGCGGTGATGACATTATGTATCGCGATCAGTTTGGTTGGCGCGACAGAT
CTGGATAAGTTTGTCGCCTTGATTGGAAGCTTCGCGTGTGTTCCACTTGTGTACATCTACCCAGCGTATTTACAC
TACCGGGGTGTTGCAAACACAACTTGGACTAGAGGGCTAGATCTTTGTGTGATGCTGCTAGGTTCTGTTGCGATG
GTTTATACGACTTTTGTAACGTTAAAACAATGGGTCAACTCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail