Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7284
Gene name
LocationContig_897:3442..5584
Strand-
Gene length (bp)2142
Transcript length (bp)2142
Coding sequence length (bp)2142
Protein length (aa) 714

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup527
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6551
Ophiocordyceps australis 1348a (Ghana) OphauG2|6552
Ophiocordyceps australis map64 (Brazil) OphauB2|1204
Ophiocordyceps camponoti-floridani Ophcf2|02797
Ophiocordyceps camponoti-rufipedis Ophun1|1250
Ophiocordyceps camponoti-rufipedis Ophun1|7284 (this protein)
Ophiocordyceps kimflemingae Ophio5|7111
Ophiocordyceps subramaniannii Hirsu2|3007

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7284
MPFPIHDGYDPQFRSNNASQMPLMDLLDMNHCFHPVNGVLPAPQRALLLRRLAIAAMGALSGDVMMRQLVEPLSI
KFEQDLRDLLAGFQAGDGGDPPDGGDGDGGAPGGNDGNGAPGGNDNGDGFNPGGNASASYNVEATDPRNLILNPL
QGHGQYQMSGADRSGDRENDGGAGMNALSTEVIQIYEDEPQNENNNNNNNNNNNGHDAGNSEVENQPPVDPALYS
SHPQSAGTGQVATVQSASSRLNEAITGPRSRPQGQQRSVLGDLDGRRFQQGGLVGSIANEAIGAHRSQPQLQQQF
QQQPQQQLQQQFQQQQLQQQFQQQPQQELQPQQPQQPQQNPPQLPSSSSSAPTNPFTSIDEDSSILHPPQSSLEN
PSPLRPMRWPGKRPQSLDASMWEYFHRESVAGNMRVSNSQLFTPIDGQQRLPNPNAGPAPLMNELRRVKAPLLDG
RTPKIFTDDGNKCGDPAQLDITDDGGACGKELQRHMVCASKDHLSDAAPHGVCDDCSQISANVTRSDRGRISELE
LEEMRAYLCTECSITPLAQLHTRLFNQGVSNIYGASLIQTSKQLISDPRPLTVHSHVFPATGCTCASKMFATRLC
RHHRLFYAQRVMQRIQAVRDWRARAFNNRLSCPTCLAVKPVSEAGLSTRLSVNHPAAWICMLCNDAVVEQADRGI
IDGWDDWFFNPSGTRPAAEDEDAEGELIEWGEESAVQG*
Coding >Ophun1|7284
ATGCCCTTCCCCATCCACGACGGATACGACCCCCAATTCCGCTCCAATAACGCCTCACAGATGCCGCTGATGGAC
CTGCTGGACATGAACCACTGCTTCCATCCCGTCAACGGCGTCCTCCCGGCCCCCCAGAGAGCCCTCCTCCTCCGC
CGACTCGCCATCGCTGCCATGGGCGCCTTGTCCGGCGACGTGATGATGCGGCAACTCGTCGAGCCACTGTCCATC
AAGTTCGAGCAGGATCTGCGAGACCTGCTTGCCGGATTCCAGGCCGGCGACGGGGGGGATCCGCCTGACGGTGGG
GACGGAGACGGAGGTGCCCCCGGCGGAAACGACGGCAATGGCGCCCCCGGAGGAAACGACAACGGCGACGGTTTC
AACCCCGGTGGCAACGCATCTGCTTCATACAATGTCGAGGCTACTGACCCGCGAAACCTCATCCTCAACCCTCTC
CAAGGTCACGGACAGTATCAGATGAGCGGTGCTGACAGGAGTGGCGATAGAGAGAATGATGGGGGGGCTGGCATG
AACGCGCTGTCAACTGAAGTCATTCAGATTTACGAAGACGAGCCGCAGAACGAGAACAACAACAACAACAACAAC
AACAACAACAACGGCCACGACGCGGGAAATTCAGAGGTAGAGAACCAACCCCCCGTCGATCCAGCCCTCTACAGC
TCTCACCCGCAATCAGCAGGTACAGGACAGGTAGCCACCGTTCAGTCTGCCTCCTCTCGGCTCAACGAGGCCATC
ACGGGTCCTCGTTCGCGTCCTCAGGGTCAGCAACGGAGCGTGCTTGGTGATCTTGATGGGCGGCGGTTTCAGCAA
GGGGGTCTTGTTGGTTCTATAGCTAATGAGGCTATTGGCGCTCACCGTTCCCAGCCGCAACTTCAGCAGCAGTTC
CAGCAGCAACCTCAACAGCAACTGCAGCAGCAGTTCCAGCAACAGCAACTCCAGCAGCAGTTCCAGCAGCAACCC
CAGCAGGAGTTACAACCCCAGCAACCCCAGCAACCCCAGCAAAACCCCCCCCAACTCCCCTCCTCCTCCTCCTCC
GCCCCAACCAACCCCTTCACCTCCATCGACGAAGACAGCTCCATCCTCCACCCCCCCCAATCCTCACTCGAAAAC
CCCTCCCCCCTCCGACCCATGCGCTGGCCCGGCAAACGGCCCCAATCCCTAGACGCCAGCATGTGGGAGTATTTC
CACCGCGAGTCCGTGGCAGGAAACATGCGCGTCTCCAACAGCCAACTCTTCACCCCCATCGACGGCCAGCAACGT
CTCCCCAATCCCAACGCCGGTCCTGCTCCGCTCATGAACGAGCTGCGCCGTGTCAAAGCACCGCTACTTGACGGC
CGCACCCCCAAGATATTCACCGACGATGGTAACAAGTGCGGTGATCCGGCTCAGCTTGATATCACTGACGACGGA
GGTGCTTGCGGCAAAGAGCTTCAACGTCACATGGTCTGCGCCTCAAAGGATCATCTCTCAGACGCAGCTCCCCAC
GGAGTCTGCGACGACTGCTCACAGATCAGCGCAAACGTCACCCGCAGCGATCGCGGACGAATCTCCGAGCTGGAA
CTGGAAGAGATGCGCGCCTACCTCTGCACCGAATGCTCCATCACTCCCCTCGCCCAACTCCACACCCGCCTCTTC
AACCAAGGCGTCTCCAACATCTACGGCGCCAGCCTCATCCAAACCTCCAAGCAGCTCATATCCGACCCGCGGCCT
CTGACCGTCCATAGCCACGTCTTCCCCGCCACGGGCTGCACCTGCGCCTCCAAGATGTTCGCCACCAGACTCTGT
CGTCACCACCGGCTCTTCTACGCCCAGCGCGTCATGCAGCGCATCCAGGCCGTCCGTGACTGGCGCGCTCGTGCC
TTCAACAACCGGCTTAGCTGCCCGACCTGCCTGGCCGTGAAGCCCGTTTCCGAAGCGGGCCTCTCGACGAGATTG
AGCGTCAACCATCCGGCGGCGTGGATCTGCATGCTCTGCAACGATGCTGTTGTCGAGCAGGCTGATCGGGGCATC
ATCGATGGGTGGGATGATTGGTTCTTTAATCCGAGCGGGACTCGGCCTGCCGCGGAGGACGAGGATGCTGAGGGG
GAGTTGATTGAGTGGGGGGAAGAGAGTGCAGTGCAGGGTTGA
Transcript >Ophun1|7284
ATGCCCTTCCCCATCCACGACGGATACGACCCCCAATTCCGCTCCAATAACGCCTCACAGATGCCGCTGATGGAC
CTGCTGGACATGAACCACTGCTTCCATCCCGTCAACGGCGTCCTCCCGGCCCCCCAGAGAGCCCTCCTCCTCCGC
CGACTCGCCATCGCTGCCATGGGCGCCTTGTCCGGCGACGTGATGATGCGGCAACTCGTCGAGCCACTGTCCATC
AAGTTCGAGCAGGATCTGCGAGACCTGCTTGCCGGATTCCAGGCCGGCGACGGGGGGGATCCGCCTGACGGTGGG
GACGGAGACGGAGGTGCCCCCGGCGGAAACGACGGCAATGGCGCCCCCGGAGGAAACGACAACGGCGACGGTTTC
AACCCCGGTGGCAACGCATCTGCTTCATACAATGTCGAGGCTACTGACCCGCGAAACCTCATCCTCAACCCTCTC
CAAGGTCACGGACAGTATCAGATGAGCGGTGCTGACAGGAGTGGCGATAGAGAGAATGATGGGGGGGCTGGCATG
AACGCGCTGTCAACTGAAGTCATTCAGATTTACGAAGACGAGCCGCAGAACGAGAACAACAACAACAACAACAAC
AACAACAACAACGGCCACGACGCGGGAAATTCAGAGGTAGAGAACCAACCCCCCGTCGATCCAGCCCTCTACAGC
TCTCACCCGCAATCAGCAGGTACAGGACAGGTAGCCACCGTTCAGTCTGCCTCCTCTCGGCTCAACGAGGCCATC
ACGGGTCCTCGTTCGCGTCCTCAGGGTCAGCAACGGAGCGTGCTTGGTGATCTTGATGGGCGGCGGTTTCAGCAA
GGGGGTCTTGTTGGTTCTATAGCTAATGAGGCTATTGGCGCTCACCGTTCCCAGCCGCAACTTCAGCAGCAGTTC
CAGCAGCAACCTCAACAGCAACTGCAGCAGCAGTTCCAGCAACAGCAACTCCAGCAGCAGTTCCAGCAGCAACCC
CAGCAGGAGTTACAACCCCAGCAACCCCAGCAACCCCAGCAAAACCCCCCCCAACTCCCCTCCTCCTCCTCCTCC
GCCCCAACCAACCCCTTCACCTCCATCGACGAAGACAGCTCCATCCTCCACCCCCCCCAATCCTCACTCGAAAAC
CCCTCCCCCCTCCGACCCATGCGCTGGCCCGGCAAACGGCCCCAATCCCTAGACGCCAGCATGTGGGAGTATTTC
CACCGCGAGTCCGTGGCAGGAAACATGCGCGTCTCCAACAGCCAACTCTTCACCCCCATCGACGGCCAGCAACGT
CTCCCCAATCCCAACGCCGGTCCTGCTCCGCTCATGAACGAGCTGCGCCGTGTCAAAGCACCGCTACTTGACGGC
CGCACCCCCAAGATATTCACCGACGATGGTAACAAGTGCGGTGATCCGGCTCAGCTTGATATCACTGACGACGGA
GGTGCTTGCGGCAAAGAGCTTCAACGTCACATGGTCTGCGCCTCAAAGGATCATCTCTCAGACGCAGCTCCCCAC
GGAGTCTGCGACGACTGCTCACAGATCAGCGCAAACGTCACCCGCAGCGATCGCGGACGAATCTCCGAGCTGGAA
CTGGAAGAGATGCGCGCCTACCTCTGCACCGAATGCTCCATCACTCCCCTCGCCCAACTCCACACCCGCCTCTTC
AACCAAGGCGTCTCCAACATCTACGGCGCCAGCCTCATCCAAACCTCCAAGCAGCTCATATCCGACCCGCGGCCT
CTGACCGTCCATAGCCACGTCTTCCCCGCCACGGGCTGCACCTGCGCCTCCAAGATGTTCGCCACCAGACTCTGT
CGTCACCACCGGCTCTTCTACGCCCAGCGCGTCATGCAGCGCATCCAGGCCGTCCGTGACTGGCGCGCTCGTGCC
TTCAACAACCGGCTTAGCTGCCCGACCTGCCTGGCCGTGAAGCCCGTTTCCGAAGCGGGCCTCTCGACGAGATTG
AGCGTCAACCATCCGGCGGCGTGGATCTGCATGCTCTGCAACGATGCTGTTGTCGAGCAGGCTGATCGGGGCATC
ATCGATGGGTGGGATGATTGGTTCTTTAATCCGAGCGGGACTCGGCCTGCCGCGGAGGACGAGGATGCTGAGGGG
GAGTTGATTGAGTGGGGGGAAGAGAGTGCAGTGCAGGGTTGA
Gene >Ophun1|7284
ATGCCCTTCCCCATCCACGACGGATACGACCCCCAATTCCGCTCCAATAACGCCTCACAGATGCCGCTGATGGAC
CTGCTGGACATGAACCACTGCTTCCATCCCGTCAACGGCGTCCTCCCGGCCCCCCAGAGAGCCCTCCTCCTCCGC
CGACTCGCCATCGCTGCCATGGGCGCCTTGTCCGGCGACGTGATGATGCGGCAACTCGTCGAGCCACTGTCCATC
AAGTTCGAGCAGGATCTGCGAGACCTGCTTGCCGGATTCCAGGCCGGCGACGGGGGGGATCCGCCTGACGGTGGG
GACGGAGACGGAGGTGCCCCCGGCGGAAACGACGGCAATGGCGCCCCCGGAGGAAACGACAACGGCGACGGTTTC
AACCCCGGTGGCAACGCATCTGCTTCATACAATGTCGAGGCTACTGACCCGCGAAACCTCATCCTCAACCCTCTC
CAAGGTCACGGACAGTATCAGATGAGCGGTGCTGACAGGAGTGGCGATAGAGAGAATGATGGGGGGGCTGGCATG
AACGCGCTGTCAACTGAAGTCATTCAGATTTACGAAGACGAGCCGCAGAACGAGAACAACAACAACAACAACAAC
AACAACAACAACGGCCACGACGCGGGAAATTCAGAGGTAGAGAACCAACCCCCCGTCGATCCAGCCCTCTACAGC
TCTCACCCGCAATCAGCAGGTACAGGACAGGTAGCCACCGTTCAGTCTGCCTCCTCTCGGCTCAACGAGGCCATC
ACGGGTCCTCGTTCGCGTCCTCAGGGTCAGCAACGGAGCGTGCTTGGTGATCTTGATGGGCGGCGGTTTCAGCAA
GGGGGTCTTGTTGGTTCTATAGCTAATGAGGCTATTGGCGCTCACCGTTCCCAGCCGCAACTTCAGCAGCAGTTC
CAGCAGCAACCTCAACAGCAACTGCAGCAGCAGTTCCAGCAACAGCAACTCCAGCAGCAGTTCCAGCAGCAACCC
CAGCAGGAGTTACAACCCCAGCAACCCCAGCAACCCCAGCAAAACCCCCCCCAACTCCCCTCCTCCTCCTCCTCC
GCCCCAACCAACCCCTTCACCTCCATCGACGAAGACAGCTCCATCCTCCACCCCCCCCAATCCTCACTCGAAAAC
CCCTCCCCCCTCCGACCCATGCGCTGGCCCGGCAAACGGCCCCAATCCCTAGACGCCAGCATGTGGGAGTATTTC
CACCGCGAGTCCGTGGCAGGAAACATGCGCGTCTCCAACAGCCAACTCTTCACCCCCATCGACGGCCAGCAACGT
CTCCCCAATCCCAACGCCGGTCCTGCTCCGCTCATGAACGAGCTGCGCCGTGTCAAAGCACCGCTACTTGACGGC
CGCACCCCCAAGATATTCACCGACGATGGTAACAAGTGCGGTGATCCGGCTCAGCTTGATATCACTGACGACGGA
GGTGCTTGCGGCAAAGAGCTTCAACGTCACATGGTCTGCGCCTCAAAGGATCATCTCTCAGACGCAGCTCCCCAC
GGAGTCTGCGACGACTGCTCACAGATCAGCGCAAACGTCACCCGCAGCGATCGCGGACGAATCTCCGAGCTGGAA
CTGGAAGAGATGCGCGCCTACCTCTGCACCGAATGCTCCATCACTCCCCTCGCCCAACTCCACACCCGCCTCTTC
AACCAAGGCGTCTCCAACATCTACGGCGCCAGCCTCATCCAAACCTCCAAGCAGCTCATATCCGACCCGCGGCCT
CTGACCGTCCATAGCCACGTCTTCCCCGCCACGGGCTGCACCTGCGCCTCCAAGATGTTCGCCACCAGACTCTGT
CGTCACCACCGGCTCTTCTACGCCCAGCGCGTCATGCAGCGCATCCAGGCCGTCCGTGACTGGCGCGCTCGTGCC
TTCAACAACCGGCTTAGCTGCCCGACCTGCCTGGCCGTGAAGCCCGTTTCCGAAGCGGGCCTCTCGACGAGATTG
AGCGTCAACCATCCGGCGGCGTGGATCTGCATGCTCTGCAACGATGCTGTTGTCGAGCAGGCTGATCGGGGCATC
ATCGATGGGTGGGATGATTGGTTCTTTAATCCGAGCGGGACTCGGCCTGCCGCGGAGGACGAGGATGCTGAGGGG
GAGTTGATTGAGTGGGGGGAAGAGAGTGCAGTGCAGGGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail