Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7281
Gene name
LocationContig_896:849..3945
Strand-
Gene length (bp)3096
Transcript length (bp)3096
Coding sequence length (bp)3096
Protein length (aa) 1032

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03372 Exo_endo_phos Endonuclease/Exonuclease/phosphatase family 1.5E-05 48 427

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q0WT19|IP5P8_ARATH Type I inositol polyphosphate 5-phosphatase 8 OS=Arabidopsis thaliana GN=IP5P8 PE=2 SV=1 108 275 1.0E-20
sp|O43426|SYNJ1_HUMAN Synaptojanin-1 OS=Homo sapiens GN=SYNJ1 PE=1 SV=2 19 287 8.0E-20
sp|Q62910|SYNJ1_RAT Synaptojanin-1 OS=Rattus norvegicus GN=Synj1 PE=1 SV=3 36 287 8.0E-20
sp|Q8CHC4|SYNJ1_MOUSE Synaptojanin-1 OS=Mus musculus GN=Synj1 PE=1 SV=3 36 287 8.0E-20
sp|O18964|SYNJ1_BOVIN Synaptojanin-1 (Fragment) OS=Bos taurus GN=SYNJ1 PE=1 SV=2 19 287 1.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q0WT19|IP5P8_ARATH Type I inositol polyphosphate 5-phosphatase 8 OS=Arabidopsis thaliana GN=IP5P8 PE=2 SV=1 108 275 1.0E-20
sp|O43426|SYNJ1_HUMAN Synaptojanin-1 OS=Homo sapiens GN=SYNJ1 PE=1 SV=2 19 287 8.0E-20
sp|Q62910|SYNJ1_RAT Synaptojanin-1 OS=Rattus norvegicus GN=Synj1 PE=1 SV=3 36 287 8.0E-20
sp|Q8CHC4|SYNJ1_MOUSE Synaptojanin-1 OS=Mus musculus GN=Synj1 PE=1 SV=3 36 287 8.0E-20
sp|O18964|SYNJ1_BOVIN Synaptojanin-1 (Fragment) OS=Bos taurus GN=SYNJ1 PE=1 SV=2 19 287 1.0E-19
sp|D3ZGS3|OCRL_RAT Inositol polyphosphate 5-phosphatase OCRL-1 OS=Rattus norvegicus GN=Ocrl PE=1 SV=1 26 288 2.0E-19
sp|Q6NVF0|OCRL_MOUSE Inositol polyphosphate 5-phosphatase OCRL-1 OS=Mus musculus GN=Ocrl PE=1 SV=1 24 296 4.0E-19
sp|Q0WQ41|IP5P7_ARATH Type IV inositol polyphosphate 5-phosphatase 7 OS=Arabidopsis thaliana GN=IP5P7 PE=1 SV=1 119 275 9.0E-19
sp|Q9FUR2|IP5P2_ARATH Type I inositol polyphosphate 5-phosphatase 2 OS=Arabidopsis thaliana GN=IP5P2 PE=1 SV=2 152 288 1.0E-18
sp|Q9SIS4|IP5P9_ARATH Type IV inositol polyphosphate 5-phosphatase 9 OS=Arabidopsis thaliana GN=IP5P9 PE=1 SV=1 34 287 1.0E-18
sp|Q9D2G5|SYNJ2_MOUSE Synaptojanin-2 OS=Mus musculus GN=Synj2 PE=1 SV=2 19 276 1.0E-18
sp|Q12271|INP53_YEAST Polyphosphatidylinositol phosphatase INP53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INP53 PE=1 SV=1 108 296 8.0E-18
sp|Q9LR47|IP5P6_ARATH Type IV inositol polyphosphate 5-phosphatase 6 OS=Arabidopsis thaliana GN=IP5P6 PE=1 SV=2 132 275 1.0E-17
sp|O55207|SYNJ2_RAT Synaptojanin-2 OS=Rattus norvegicus GN=Synj2 PE=1 SV=2 21 276 2.0E-17
sp|Q01968|OCRL_HUMAN Inositol polyphosphate 5-phosphatase OCRL-1 OS=Homo sapiens GN=OCRL PE=1 SV=3 26 288 3.0E-17
sp|P32019|I5P2_HUMAN Type II inositol 1,4,5-trisphosphate 5-phosphatase OS=Homo sapiens GN=INPP5B PE=1 SV=4 443 760 3.0E-17
sp|Q8GTS0|IP5P4_ARATH Type I inositol polyphosphate 5-phosphatase 4 OS=Arabidopsis thaliana GN=IP5P4 PE=2 SV=1 150 275 3.0E-17
sp|O15056|SYNJ2_HUMAN Synaptojanin-2 OS=Homo sapiens GN=SYNJ2 PE=1 SV=3 19 276 9.0E-17
sp|Q15735|PI5PA_HUMAN Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A OS=Homo sapiens GN=INPP5J PE=1 SV=3 108 277 2.0E-16
sp|P59644|PI5PA_MOUSE Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A OS=Mus musculus GN=Inpp5j PE=1 SV=2 108 277 2.0E-16
sp|Q66GQ6|IP5P5_ARATH Type I inositol polyphosphate 5-phosphatase 5 OS=Arabidopsis thaliana GN=IP5P5 PE=2 SV=1 152 287 2.0E-16
sp|Q9JMC1|PI5PA_RAT Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A OS=Rattus norvegicus GN=Inpp5j PE=1 SV=1 108 277 2.0E-16
sp|D3ZGS3|OCRL_RAT Inositol polyphosphate 5-phosphatase OCRL-1 OS=Rattus norvegicus GN=Ocrl PE=1 SV=1 522 895 3.0E-16
sp|Q01968|OCRL_HUMAN Inositol polyphosphate 5-phosphatase OCRL-1 OS=Homo sapiens GN=OCRL PE=1 SV=3 522 895 6.0E-16
sp|Q6NVF0|OCRL_MOUSE Inositol polyphosphate 5-phosphatase OCRL-1 OS=Mus musculus GN=Ocrl PE=1 SV=1 522 895 6.0E-16
sp|O43001|SYJ1_SCHPO Inositol-1,4,5-trisphosphate 5-phosphatase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=syj1 PE=1 SV=1 14 275 1.0E-15
sp|Q8K337|I5P2_MOUSE Type II inositol 1,4,5-trisphosphate 5-phosphatase OS=Mus musculus GN=Inpp5b PE=1 SV=1 108 287 2.0E-15
sp|Q8H0Z6|IP5P3_ARATH Type IV inositol polyphosphate 5-phosphatase 3 OS=Arabidopsis thaliana GN=IP5P3 PE=1 SV=1 151 275 3.0E-15
sp|P50942|INP52_YEAST Polyphosphatidylinositol phosphatase INP52 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INP52 PE=1 SV=1 110 296 4.0E-15
sp|P32019|I5P2_HUMAN Type II inositol 1,4,5-trisphosphate 5-phosphatase OS=Homo sapiens GN=INPP5B PE=1 SV=4 108 287 8.0E-15
sp|Q8C5L6|INP5K_MOUSE Inositol polyphosphate 5-phosphatase K OS=Mus musculus GN=Inpp5k PE=1 SV=2 105 278 8.0E-15
sp|Q9BT40|INP5K_HUMAN Inositol polyphosphate 5-phosphatase K OS=Homo sapiens GN=INPP5K PE=1 SV=3 108 278 8.0E-15
sp|Q84MA2|IP5P1_ARATH Type I inositol polyphosphate 5-phosphatase 1 OS=Arabidopsis thaliana GN=IP5P1 PE=1 SV=2 151 287 2.0E-14
sp|O14306|YE8A_SCHPO Probable inositol polyphosphate 5-phosphatase C9G1.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC9G1.10c PE=1 SV=2 108 278 1.0E-12
sp|A8MR21|IP5PA_ARATH Type I inositol polyphosphate 5-phosphatase 10 OS=Arabidopsis thaliana GN=IP5P10 PE=2 SV=1 152 275 3.0E-12
sp|Q6P4S2|SHIP1_XENLA Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1 OS=Xenopus laevis GN=inpp5d PE=2 SV=1 43 282 9.0E-12
sp|P40559|INP51_YEAST Phosphatidylinositol 4,5-bisphosphate 5-phosphatase INP51 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INP51 PE=1 SV=1 26 285 1.0E-10
sp|Q8K337|I5P2_MOUSE Type II inositol 1,4,5-trisphosphate 5-phosphatase OS=Mus musculus GN=Inpp5b PE=1 SV=1 360 569 1.0E-10
sp|Q2I6J0|SHP2B_DANRE Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2B OS=Danio rerio GN=inppl1b PE=2 SV=1 43 276 4.0E-10
sp|Q9SKB7|IP5PE_ARATH Type II inositol polyphosphate 5-phosphatase 14 OS=Arabidopsis thaliana GN=IP5P14 PE=1 SV=1 351 425 5.0E-10
sp|Q9WVR1|INP5E_RAT 72 kDa inositol polyphosphate 5-phosphatase OS=Rattus norvegicus GN=Inpp5e PE=1 SV=2 365 427 1.0E-09
sp|Q9JII1|INP5E_MOUSE 72 kDa inositol polyphosphate 5-phosphatase OS=Mus musculus GN=Inpp5e PE=1 SV=1 365 427 2.0E-09
sp|Q9NRR6|INP5E_HUMAN 72 kDa inositol polyphosphate 5-phosphatase OS=Homo sapiens GN=INPP5E PE=1 SV=2 363 427 2.0E-09
sp|A0FI79|INP5E_PANTR 72 kDa inositol polyphosphate 5-phosphatase OS=Pan troglodytes GN=INPP5E PE=2 SV=1 363 427 2.0E-09
sp|Q62910|SYNJ1_RAT Synaptojanin-1 OS=Rattus norvegicus GN=Synj1 PE=1 SV=3 349 467 3.0E-09
sp|Q8CHC4|SYNJ1_MOUSE Synaptojanin-1 OS=Mus musculus GN=Synj1 PE=1 SV=3 360 467 3.0E-09
sp|O18964|SYNJ1_BOVIN Synaptojanin-1 (Fragment) OS=Bos taurus GN=SYNJ1 PE=1 SV=2 349 467 3.0E-09
sp|D3ZGS3|OCRL_RAT Inositol polyphosphate 5-phosphatase OCRL-1 OS=Rattus norvegicus GN=Ocrl PE=1 SV=1 360 444 3.0E-09
sp|O43426|SYNJ1_HUMAN Synaptojanin-1 OS=Homo sapiens GN=SYNJ1 PE=1 SV=2 349 467 5.0E-09
sp|Q6NVF0|OCRL_MOUSE Inositol polyphosphate 5-phosphatase OCRL-1 OS=Mus musculus GN=Ocrl PE=1 SV=1 360 444 5.0E-09
sp|Q9USQ6|SYJ2_SCHPO Inositol-1,4,5-trisphosphate 5-phosphatase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=syj2 PE=2 SV=1 108 289 9.0E-09
sp|Q9SYK4|IP5PD_ARATH Type I inositol polyphosphate 5-phosphatase 13 OS=Arabidopsis thaliana GN=IP5P13 PE=1 SV=1 351 425 1.0E-08
sp|Q84W55|IP5PF_ARATH Type II inositol polyphosphate 5-phosphatase 15 OS=Arabidopsis thaliana GN=IP5P15 PE=1 SV=2 24 288 1.0E-08
sp|O43001|SYJ1_SCHPO Inositol-1,4,5-trisphosphate 5-phosphatase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=syj1 PE=1 SV=1 356 457 1.0E-08
sp|Q01968|OCRL_HUMAN Inositol polyphosphate 5-phosphatase OCRL-1 OS=Homo sapiens GN=OCRL PE=1 SV=3 363 444 1.0E-08
sp|Q12271|INP53_YEAST Polyphosphatidylinositol phosphatase INP53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INP53 PE=1 SV=1 363 425 2.0E-08
sp|Q84W55|IP5PF_ARATH Type II inositol polyphosphate 5-phosphatase 15 OS=Arabidopsis thaliana GN=IP5P15 PE=1 SV=2 347 428 3.0E-08
sp|O55207|SYNJ2_RAT Synaptojanin-2 OS=Rattus norvegicus GN=Synj2 PE=1 SV=2 364 435 5.0E-08
sp|Q9USQ6|SYJ2_SCHPO Inositol-1,4,5-trisphosphate 5-phosphatase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=syj2 PE=2 SV=1 363 443 5.0E-08
sp|P50942|INP52_YEAST Polyphosphatidylinositol phosphatase INP52 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INP52 PE=1 SV=1 363 425 6.0E-08
sp|P32019|I5P2_HUMAN Type II inositol 1,4,5-trisphosphate 5-phosphatase OS=Homo sapiens GN=INPP5B PE=1 SV=4 363 431 6.0E-08
sp|O15056|SYNJ2_HUMAN Synaptojanin-2 OS=Homo sapiens GN=SYNJ2 PE=1 SV=3 364 428 8.0E-08
sp|O80560|IP5PC_ARATH Type I inositol polyphosphate 5-phosphatase 12 OS=Arabidopsis thaliana GN=IP5P12 PE=1 SV=2 351 444 8.0E-08
sp|Q9D2G5|SYNJ2_MOUSE Synaptojanin-2 OS=Mus musculus GN=Synj2 PE=1 SV=2 364 435 9.0E-08
sp|Q0WT19|IP5P8_ARATH Type I inositol polyphosphate 5-phosphatase 8 OS=Arabidopsis thaliana GN=IP5P8 PE=2 SV=1 364 433 1.0E-07
sp|Q9FUR2|IP5P2_ARATH Type I inositol polyphosphate 5-phosphatase 2 OS=Arabidopsis thaliana GN=IP5P2 PE=1 SV=2 360 444 2.0E-07
sp|Q5EAF2|IP5PB_ARATH Type IV inositol polyphosphate 5-phosphatase 11 OS=Arabidopsis thaliana GN=IP5P11 PE=1 SV=1 349 427 4.0E-07
sp|O14306|YE8A_SCHPO Probable inositol polyphosphate 5-phosphatase C9G1.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC9G1.10c PE=1 SV=2 343 444 5.0E-07
sp|Q84MA2|IP5P1_ARATH Type I inositol polyphosphate 5-phosphatase 1 OS=Arabidopsis thaliana GN=IP5P1 PE=1 SV=2 364 436 8.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2429
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1554
Ophiocordyceps australis map64 (Brazil) OphauB2|4799
Ophiocordyceps camponoti-floridani Ophcf2|03036
Ophiocordyceps camponoti-rufipedis Ophun1|7281 (this protein)
Ophiocordyceps kimflemingae Ophio5|5770
Ophiocordyceps subramaniannii Hirsu2|3446

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7281
MTTSSRPASSFASEPVDLLAATPHALTRALIARRSEYVRHHQIRVKVGTWNVAACPGTDKDLAGWFVAGRGLDDA
LTGLDLRRSSAVEVTKSGCSESVRLVGGEEIGLYVLGLQEVVDLNTTREYMNRAVYTDHGPRQKWQAALEAALPA
GYQLVVAEQMTGILLLVYASPEVAPTISNVSTKQVGTGLLGYFGNKGAVTTRLVLGETTRMVFVNCHLASGASSN
ALDRRCWDVGQILAKTRFDAVVHGGVAEDDGEGIGDEDFCFWMGDLNFRLENLPGEDIRRLLTLHTRGEYDVDPD
RPPAPLDGDGFIVMRSSESDDDASTITSAHSRERSYDSKGSGPDAIDFLDDPSQDPVSLQSTLESLLPHDQLRRL
MNQRKLFHDGWREGRISFLPSYKYDVGTIGLFDSSDKKRAPSWCDRILYRTRKDKQAYDRRVSDEAAVSRKDAEM
KTRGIEEDDDVLFSYDPDADGEDEDEEDHQQRQRLSKGSPRVEYDEYDDAATEDGGTPGDEVVTKEGFVDRVSQE
LYASHQRITSSDHKPVVSVFTLDYDAVVPELKAQVHAEVARELDRVENEGRPAITVVVEGDRQQQQQQQQQQQQP
EGVVDFGSLGFLERKMCALTIANTGSVVATFAFVEKPRTVMAGEGEGDEHADMAPSWLTTCFVRTDNGSGDGDDD
GGGGPATEELMDSVALEPGETVSAHIEASVSAVSLLRALNDGQAKLEDILVLRVEDGRDHFVPVRASWLPSCFGR
SVEELIRVPESGGIRGFVLDRGIRGAIPYDSDVRCSAPRELFKLTEAMQTLAERCAADEAMLEDMRLPRDPGWPF
QPSPAMAFTGLAEAARADLVAALDTDAPLIRALPLELSSAHKLEIVSSVMLLFLSALTDGLVPPLLCAKLSSALP
PNLVGLPTTAVADVKMQVLDVLSSAPNHNIAFVFLTATASRVASELSPSTGESGDSSATAGALSGLSRRLSFRRG
SSDDDGSRMRRAREKKYAEILGPLVFRAGGEGDKDKAAMERERAVMDMFLCREARG*
Coding >Ophun1|7281
ATGACGACCTCTTCGCGACCGGCGTCGTCGTTCGCGTCCGAGCCGGTCGATCTCCTGGCCGCGACGCCGCATGCG
CTGACGCGAGCCCTCATCGCCAGACGCTCCGAGTACGTCCGCCATCACCAGATCCGCGTCAAGGTCGGCACTTGG
AACGTGGCCGCGTGTCCGGGGACGGACAAGGATCTGGCTGGCTGGTTCGTTGCGGGCCGTGGTCTCGATGACGCT
CTTACCGGTCTGGATCTGAGGCGCAGCTCGGCCGTCGAGGTGACCAAGTCGGGCTGCTCCGAATCTGTTCGGCTT
GTGGGCGGGGAGGAGATTGGCCTCTACGTTCTGGGGCTACAGGAGGTGGTGGACCTGAACACGACGAGGGAATAC
ATGAATCGCGCCGTCTATACCGATCACGGGCCTCGACAGAAATGGCAAGCCGCTCTCGAAGCCGCGCTGCCGGCC
GGGTATCAGCTCGTTGTCGCCGAGCAAATGACGGGTATACTGCTGCTCGTGTACGCGTCGCCAGAGGTGGCGCCC
ACCATTAGCAACGTGAGCACCAAGCAGGTCGGCACAGGCTTGCTGGGCTACTTTGGCAACAAGGGTGCCGTCACG
ACGCGGCTGGTCCTGGGCGAGACGACTCGGATGGTGTTTGTCAACTGCCATCTCGCTAGTGGCGCGAGCTCCAAT
GCCCTGGACCGCCGGTGCTGGGACGTGGGTCAGATATTGGCCAAGACCAGGTTTGATGCCGTCGTTCACGGGGGC
GTTGCCGAAGATGACGGTGAGGGCATCGGTGACGAGGATTTCTGCTTCTGGATGGGGGATCTCAACTTCCGGCTT
GAGAACCTGCCTGGGGAAGACATCCGGAGGCTGTTAACGCTGCATACCCGTGGTGAGTACGACGTCGATCCGGAC
CGGCCTCCAGCGCCCCTCGACGGCGACGGCTTCATCGTCATGAGGAGCAGCGAGAGCGATGATGATGCTAGCACC
ATCACGTCTGCGCACTCGCGCGAACGGAGCTACGACTCGAAAGGCTCAGGTCCCGACGCCATCGACTTCCTCGAC
GATCCCAGCCAGGACCCCGTGTCGCTGCAATCCACGCTCGAATCGCTTCTGCCTCACGATCAGCTGAGGCGTCTC
ATGAACCAGCGCAAGCTCTTTCACGATGGCTGGAGGGAAGGCCGCATCTCCTTTCTTCCCTCTTACAAGTACGAC
GTCGGCACCATCGGCCTGTTTGACTCGAGCGACAAGAAGCGCGCGCCGAGCTGGTGCGATCGCATTCTGTATCGA
ACACGAAAGGACAAGCAGGCCTATGACCGGCGCGTCTCTGACGAGGCAGCCGTCAGTCGCAAGGACGCCGAGATG
AAGACGAGGGGGATCGAGGAGGACGATGACGTCTTGTTCAGTTACGACCCGGACGCCGATGGCGAGGACGAGGAC
GAAGAAGATCATCAACAGCGGCAGAGGCTATCCAAGGGCAGCCCACGCGTCGAATACGACGAGTACGACGATGCG
GCAACGGAGGATGGCGGCACGCCGGGAGACGAGGTCGTCACCAAGGAGGGCTTCGTCGACCGCGTGAGCCAAGAG
TTGTACGCCTCTCACCAGCGCATCACGTCGTCGGACCATAAACCCGTAGTGTCCGTCTTCACACTCGACTACGAC
GCCGTCGTACCGGAGCTCAAGGCCCAGGTGCACGCCGAGGTGGCACGCGAGCTCGATCGGGTAGAGAACGAGGGT
CGACCGGCCATTACGGTGGTTGTCGAGGGAGACAGACAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCCC
GAAGGCGTCGTCGACTTTGGGTCACTCGGCTTCCTCGAGCGCAAGATGTGCGCACTGACCATTGCGAATACGGGA
AGCGTAGTCGCCACTTTTGCCTTTGTGGAGAAGCCGAGGACCGTGATGGCGGGTGAGGGCGAGGGAGATGAGCAT
GCTGACATGGCACCGAGCTGGCTGACGACGTGCTTCGTCCGGACCGACAACGGGAGCGGTGACGGCGATGACGAC
GGTGGCGGCGGGCCCGCGACGGAAGAGCTGATGGATTCAGTGGCGCTCGAGCCTGGAGAGACGGTCTCGGCGCAT
ATCGAGGCCAGCGTGTCGGCCGTGTCACTGCTGCGAGCGCTCAACGACGGTCAGGCCAAGCTGGAAGACATCCTG
GTGCTGAGAGTCGAGGACGGACGCGATCACTTCGTGCCCGTACGAGCCTCATGGCTGCCGTCGTGCTTCGGCCGG
TCCGTGGAGGAGCTGATCCGCGTGCCCGAGAGCGGTGGCATCCGAGGCTTCGTGCTCGACAGGGGCATCCGGGGC
GCGATACCGTACGACTCGGACGTGCGCTGCTCGGCGCCGCGGGAGCTGTTCAAGCTGACCGAGGCGATGCAGACG
CTGGCGGAGCGCTGTGCGGCCGACGAGGCCATGCTGGAGGATATGAGGCTCCCGCGAGATCCGGGCTGGCCGTTT
CAGCCGTCTCCAGCCATGGCCTTCACCGGGCTCGCCGAGGCTGCCAGGGCGGACTTGGTCGCGGCTCTCGACACG
GACGCGCCTCTCATCAGGGCCCTTCCGCTGGAGCTGTCTTCGGCGCACAAGCTCGAGATCGTGTCGTCGGTGATG
CTGCTCTTCCTTTCAGCTCTGACGGACGGGCTCGTGCCGCCGCTGCTGTGCGCTAAGCTGTCCTCCGCGTTACCA
CCTAACCTGGTCGGCCTCCCAACGACGGCCGTAGCCGACGTCAAGATGCAGGTCCTGGACGTGCTCTCTTCAGCG
CCCAATCACAACATCGCCTTTGTCTTCCTGACGGCGACGGCGTCCCGGGTGGCGTCGGAGCTGAGCCCGAGCACG
GGAGAGTCGGGGGACTCGTCGGCGACAGCTGGTGCCCTTTCCGGCCTGAGCCGACGGCTGAGCTTCCGCCGCGGA
AGCAGTGACGACGACGGCTCGAGGATGAGACGGGCTCGCGAGAAGAAGTACGCTGAGATCCTGGGGCCGCTCGTC
TTTCGCGCGGGCGGTGAGGGGGACAAGGATAAGGCGGCGATGGAGAGGGAGCGGGCCGTCATGGACATGTTTCTG
TGTCGCGAGGCCAGAGGCTAG
Transcript >Ophun1|7281
ATGACGACCTCTTCGCGACCGGCGTCGTCGTTCGCGTCCGAGCCGGTCGATCTCCTGGCCGCGACGCCGCATGCG
CTGACGCGAGCCCTCATCGCCAGACGCTCCGAGTACGTCCGCCATCACCAGATCCGCGTCAAGGTCGGCACTTGG
AACGTGGCCGCGTGTCCGGGGACGGACAAGGATCTGGCTGGCTGGTTCGTTGCGGGCCGTGGTCTCGATGACGCT
CTTACCGGTCTGGATCTGAGGCGCAGCTCGGCCGTCGAGGTGACCAAGTCGGGCTGCTCCGAATCTGTTCGGCTT
GTGGGCGGGGAGGAGATTGGCCTCTACGTTCTGGGGCTACAGGAGGTGGTGGACCTGAACACGACGAGGGAATAC
ATGAATCGCGCCGTCTATACCGATCACGGGCCTCGACAGAAATGGCAAGCCGCTCTCGAAGCCGCGCTGCCGGCC
GGGTATCAGCTCGTTGTCGCCGAGCAAATGACGGGTATACTGCTGCTCGTGTACGCGTCGCCAGAGGTGGCGCCC
ACCATTAGCAACGTGAGCACCAAGCAGGTCGGCACAGGCTTGCTGGGCTACTTTGGCAACAAGGGTGCCGTCACG
ACGCGGCTGGTCCTGGGCGAGACGACTCGGATGGTGTTTGTCAACTGCCATCTCGCTAGTGGCGCGAGCTCCAAT
GCCCTGGACCGCCGGTGCTGGGACGTGGGTCAGATATTGGCCAAGACCAGGTTTGATGCCGTCGTTCACGGGGGC
GTTGCCGAAGATGACGGTGAGGGCATCGGTGACGAGGATTTCTGCTTCTGGATGGGGGATCTCAACTTCCGGCTT
GAGAACCTGCCTGGGGAAGACATCCGGAGGCTGTTAACGCTGCATACCCGTGGTGAGTACGACGTCGATCCGGAC
CGGCCTCCAGCGCCCCTCGACGGCGACGGCTTCATCGTCATGAGGAGCAGCGAGAGCGATGATGATGCTAGCACC
ATCACGTCTGCGCACTCGCGCGAACGGAGCTACGACTCGAAAGGCTCAGGTCCCGACGCCATCGACTTCCTCGAC
GATCCCAGCCAGGACCCCGTGTCGCTGCAATCCACGCTCGAATCGCTTCTGCCTCACGATCAGCTGAGGCGTCTC
ATGAACCAGCGCAAGCTCTTTCACGATGGCTGGAGGGAAGGCCGCATCTCCTTTCTTCCCTCTTACAAGTACGAC
GTCGGCACCATCGGCCTGTTTGACTCGAGCGACAAGAAGCGCGCGCCGAGCTGGTGCGATCGCATTCTGTATCGA
ACACGAAAGGACAAGCAGGCCTATGACCGGCGCGTCTCTGACGAGGCAGCCGTCAGTCGCAAGGACGCCGAGATG
AAGACGAGGGGGATCGAGGAGGACGATGACGTCTTGTTCAGTTACGACCCGGACGCCGATGGCGAGGACGAGGAC
GAAGAAGATCATCAACAGCGGCAGAGGCTATCCAAGGGCAGCCCACGCGTCGAATACGACGAGTACGACGATGCG
GCAACGGAGGATGGCGGCACGCCGGGAGACGAGGTCGTCACCAAGGAGGGCTTCGTCGACCGCGTGAGCCAAGAG
TTGTACGCCTCTCACCAGCGCATCACGTCGTCGGACCATAAACCCGTAGTGTCCGTCTTCACACTCGACTACGAC
GCCGTCGTACCGGAGCTCAAGGCCCAGGTGCACGCCGAGGTGGCACGCGAGCTCGATCGGGTAGAGAACGAGGGT
CGACCGGCCATTACGGTGGTTGTCGAGGGAGACAGACAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCCC
GAAGGCGTCGTCGACTTTGGGTCACTCGGCTTCCTCGAGCGCAAGATGTGCGCACTGACCATTGCGAATACGGGA
AGCGTAGTCGCCACTTTTGCCTTTGTGGAGAAGCCGAGGACCGTGATGGCGGGTGAGGGCGAGGGAGATGAGCAT
GCTGACATGGCACCGAGCTGGCTGACGACGTGCTTCGTCCGGACCGACAACGGGAGCGGTGACGGCGATGACGAC
GGTGGCGGCGGGCCCGCGACGGAAGAGCTGATGGATTCAGTGGCGCTCGAGCCTGGAGAGACGGTCTCGGCGCAT
ATCGAGGCCAGCGTGTCGGCCGTGTCACTGCTGCGAGCGCTCAACGACGGTCAGGCCAAGCTGGAAGACATCCTG
GTGCTGAGAGTCGAGGACGGACGCGATCACTTCGTGCCCGTACGAGCCTCATGGCTGCCGTCGTGCTTCGGCCGG
TCCGTGGAGGAGCTGATCCGCGTGCCCGAGAGCGGTGGCATCCGAGGCTTCGTGCTCGACAGGGGCATCCGGGGC
GCGATACCGTACGACTCGGACGTGCGCTGCTCGGCGCCGCGGGAGCTGTTCAAGCTGACCGAGGCGATGCAGACG
CTGGCGGAGCGCTGTGCGGCCGACGAGGCCATGCTGGAGGATATGAGGCTCCCGCGAGATCCGGGCTGGCCGTTT
CAGCCGTCTCCAGCCATGGCCTTCACCGGGCTCGCCGAGGCTGCCAGGGCGGACTTGGTCGCGGCTCTCGACACG
GACGCGCCTCTCATCAGGGCCCTTCCGCTGGAGCTGTCTTCGGCGCACAAGCTCGAGATCGTGTCGTCGGTGATG
CTGCTCTTCCTTTCAGCTCTGACGGACGGGCTCGTGCCGCCGCTGCTGTGCGCTAAGCTGTCCTCCGCGTTACCA
CCTAACCTGGTCGGCCTCCCAACGACGGCCGTAGCCGACGTCAAGATGCAGGTCCTGGACGTGCTCTCTTCAGCG
CCCAATCACAACATCGCCTTTGTCTTCCTGACGGCGACGGCGTCCCGGGTGGCGTCGGAGCTGAGCCCGAGCACG
GGAGAGTCGGGGGACTCGTCGGCGACAGCTGGTGCCCTTTCCGGCCTGAGCCGACGGCTGAGCTTCCGCCGCGGA
AGCAGTGACGACGACGGCTCGAGGATGAGACGGGCTCGCGAGAAGAAGTACGCTGAGATCCTGGGGCCGCTCGTC
TTTCGCGCGGGCGGTGAGGGGGACAAGGATAAGGCGGCGATGGAGAGGGAGCGGGCCGTCATGGACATGTTTCTG
TGTCGCGAGGCCAGAGGCTAG
Gene >Ophun1|7281
ATGACGACCTCTTCGCGACCGGCGTCGTCGTTCGCGTCCGAGCCGGTCGATCTCCTGGCCGCGACGCCGCATGCG
CTGACGCGAGCCCTCATCGCCAGACGCTCCGAGTACGTCCGCCATCACCAGATCCGCGTCAAGGTCGGCACTTGG
AACGTGGCCGCGTGTCCGGGGACGGACAAGGATCTGGCTGGCTGGTTCGTTGCGGGCCGTGGTCTCGATGACGCT
CTTACCGGTCTGGATCTGAGGCGCAGCTCGGCCGTCGAGGTGACCAAGTCGGGCTGCTCCGAATCTGTTCGGCTT
GTGGGCGGGGAGGAGATTGGCCTCTACGTTCTGGGGCTACAGGAGGTGGTGGACCTGAACACGACGAGGGAATAC
ATGAATCGCGCCGTCTATACCGATCACGGGCCTCGACAGAAATGGCAAGCCGCTCTCGAAGCCGCGCTGCCGGCC
GGGTATCAGCTCGTTGTCGCCGAGCAAATGACGGGTATACTGCTGCTCGTGTACGCGTCGCCAGAGGTGGCGCCC
ACCATTAGCAACGTGAGCACCAAGCAGGTCGGCACAGGCTTGCTGGGCTACTTTGGCAACAAGGGTGCCGTCACG
ACGCGGCTGGTCCTGGGCGAGACGACTCGGATGGTGTTTGTCAACTGCCATCTCGCTAGTGGCGCGAGCTCCAAT
GCCCTGGACCGCCGGTGCTGGGACGTGGGTCAGATATTGGCCAAGACCAGGTTTGATGCCGTCGTTCACGGGGGC
GTTGCCGAAGATGACGGTGAGGGCATCGGTGACGAGGATTTCTGCTTCTGGATGGGGGATCTCAACTTCCGGCTT
GAGAACCTGCCTGGGGAAGACATCCGGAGGCTGTTAACGCTGCATACCCGTGGTGAGTACGACGTCGATCCGGAC
CGGCCTCCAGCGCCCCTCGACGGCGACGGCTTCATCGTCATGAGGAGCAGCGAGAGCGATGATGATGCTAGCACC
ATCACGTCTGCGCACTCGCGCGAACGGAGCTACGACTCGAAAGGCTCAGGTCCCGACGCCATCGACTTCCTCGAC
GATCCCAGCCAGGACCCCGTGTCGCTGCAATCCACGCTCGAATCGCTTCTGCCTCACGATCAGCTGAGGCGTCTC
ATGAACCAGCGCAAGCTCTTTCACGATGGCTGGAGGGAAGGCCGCATCTCCTTTCTTCCCTCTTACAAGTACGAC
GTCGGCACCATCGGCCTGTTTGACTCGAGCGACAAGAAGCGCGCGCCGAGCTGGTGCGATCGCATTCTGTATCGA
ACACGAAAGGACAAGCAGGCCTATGACCGGCGCGTCTCTGACGAGGCAGCCGTCAGTCGCAAGGACGCCGAGATG
AAGACGAGGGGGATCGAGGAGGACGATGACGTCTTGTTCAGTTACGACCCGGACGCCGATGGCGAGGACGAGGAC
GAAGAAGATCATCAACAGCGGCAGAGGCTATCCAAGGGCAGCCCACGCGTCGAATACGACGAGTACGACGATGCG
GCAACGGAGGATGGCGGCACGCCGGGAGACGAGGTCGTCACCAAGGAGGGCTTCGTCGACCGCGTGAGCCAAGAG
TTGTACGCCTCTCACCAGCGCATCACGTCGTCGGACCATAAACCCGTAGTGTCCGTCTTCACACTCGACTACGAC
GCCGTCGTACCGGAGCTCAAGGCCCAGGTGCACGCCGAGGTGGCACGCGAGCTCGATCGGGTAGAGAACGAGGGT
CGACCGGCCATTACGGTGGTTGTCGAGGGAGACAGACAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCCC
GAAGGCGTCGTCGACTTTGGGTCACTCGGCTTCCTCGAGCGCAAGATGTGCGCACTGACCATTGCGAATACGGGA
AGCGTAGTCGCCACTTTTGCCTTTGTGGAGAAGCCGAGGACCGTGATGGCGGGTGAGGGCGAGGGAGATGAGCAT
GCTGACATGGCACCGAGCTGGCTGACGACGTGCTTCGTCCGGACCGACAACGGGAGCGGTGACGGCGATGACGAC
GGTGGCGGCGGGCCCGCGACGGAAGAGCTGATGGATTCAGTGGCGCTCGAGCCTGGAGAGACGGTCTCGGCGCAT
ATCGAGGCCAGCGTGTCGGCCGTGTCACTGCTGCGAGCGCTCAACGACGGTCAGGCCAAGCTGGAAGACATCCTG
GTGCTGAGAGTCGAGGACGGACGCGATCACTTCGTGCCCGTACGAGCCTCATGGCTGCCGTCGTGCTTCGGCCGG
TCCGTGGAGGAGCTGATCCGCGTGCCCGAGAGCGGTGGCATCCGAGGCTTCGTGCTCGACAGGGGCATCCGGGGC
GCGATACCGTACGACTCGGACGTGCGCTGCTCGGCGCCGCGGGAGCTGTTCAAGCTGACCGAGGCGATGCAGACG
CTGGCGGAGCGCTGTGCGGCCGACGAGGCCATGCTGGAGGATATGAGGCTCCCGCGAGATCCGGGCTGGCCGTTT
CAGCCGTCTCCAGCCATGGCCTTCACCGGGCTCGCCGAGGCTGCCAGGGCGGACTTGGTCGCGGCTCTCGACACG
GACGCGCCTCTCATCAGGGCCCTTCCGCTGGAGCTGTCTTCGGCGCACAAGCTCGAGATCGTGTCGTCGGTGATG
CTGCTCTTCCTTTCAGCTCTGACGGACGGGCTCGTGCCGCCGCTGCTGTGCGCTAAGCTGTCCTCCGCGTTACCA
CCTAACCTGGTCGGCCTCCCAACGACGGCCGTAGCCGACGTCAAGATGCAGGTCCTGGACGTGCTCTCTTCAGCG
CCCAATCACAACATCGCCTTTGTCTTCCTGACGGCGACGGCGTCCCGGGTGGCGTCGGAGCTGAGCCCGAGCACG
GGAGAGTCGGGGGACTCGTCGGCGACAGCTGGTGCCCTTTCCGGCCTGAGCCGACGGCTGAGCTTCCGCCGCGGA
AGCAGTGACGACGACGGCTCGAGGATGAGACGGGCTCGCGAGAAGAAGTACGCTGAGATCCTGGGGCCGCTCGTC
TTTCGCGCGGGCGGTGAGGGGGACAAGGATAAGGCGGCGATGGAGAGGGAGCGGGCCGTCATGGACATGTTTCTG
TGTCGCGAGGCCAGAGGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail