Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7280
Gene name
LocationContig_895:4774..5827
Strand-
Gene length (bp)1053
Transcript length (bp)1053
Coding sequence length (bp)1053
Protein length (aa) 351

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01588 tRNA_bind Putative tRNA binding domain 9.0E-23 166 276

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P46672|ARC1_YEAST tRNA-aminoacylation cofactor ARC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARC1 PE=1 SV=2 7 350 7.0E-53
sp|Q9P6K7|ARC1_SCHPO tRNA-aminoacylation cofactor arc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC30C2.04 PE=3 SV=1 12 344 2.0E-43
sp|O54873|AIMP1_CRIGR Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 OS=Cricetulus griseus GN=AIMP1 PE=2 SV=1 148 350 2.0E-40
sp|P31230|AIMP1_MOUSE Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 OS=Mus musculus GN=Aimp1 PE=1 SV=2 156 350 2.0E-40
sp|Q12904|AIMP1_HUMAN Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 OS=Homo sapiens GN=AIMP1 PE=1 SV=2 156 350 3.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P46672|ARC1_YEAST tRNA-aminoacylation cofactor ARC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARC1 PE=1 SV=2 7 350 7.0E-53
sp|Q9P6K7|ARC1_SCHPO tRNA-aminoacylation cofactor arc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC30C2.04 PE=3 SV=1 12 344 2.0E-43
sp|O54873|AIMP1_CRIGR Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 OS=Cricetulus griseus GN=AIMP1 PE=2 SV=1 148 350 2.0E-40
sp|P31230|AIMP1_MOUSE Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 OS=Mus musculus GN=Aimp1 PE=1 SV=2 156 350 2.0E-40
sp|Q12904|AIMP1_HUMAN Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 OS=Homo sapiens GN=AIMP1 PE=1 SV=2 156 350 3.0E-40
sp|Q9ZTS1|SYM_ORYSJ Probable methionine--tRNA ligase OS=Oryza sativa subsp. japonica GN=Os06g0508700 PE=2 SV=2 119 350 6.0E-39
sp|Q9SVN5|SYMC_ARATH Methionine--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana GN=At4g13780 PE=2 SV=1 124 350 2.0E-35
sp|Q7ZX51|SYYC_XENLA Tyrosine--tRNA ligase, cytoplasmic OS=Xenopus laevis GN=yars PE=2 SV=1 122 349 1.0E-32
sp|Q6DIJ1|SYYC_XENTR Tyrosine--tRNA ligase, cytoplasmic OS=Xenopus tropicalis GN=yars PE=2 SV=1 159 349 2.0E-32
sp|Q4KM49|SYYC_RAT Tyrosine--tRNA ligase, cytoplasmic OS=Rattus norvegicus GN=Yars PE=2 SV=3 145 309 2.0E-31
sp|Q29465|SYYC_BOVIN Tyrosine--tRNA ligase, cytoplasmic OS=Bos taurus GN=YARS PE=2 SV=4 145 309 4.0E-31
sp|Q91WQ3|SYYC_MOUSE Tyrosine--tRNA ligase, cytoplasmic OS=Mus musculus GN=Yars PE=1 SV=3 126 309 3.0E-30
sp|Q5R8T5|SYYC_PONAB Tyrosine--tRNA ligase, cytoplasmic OS=Pongo abelii GN=YARS PE=2 SV=3 126 309 3.0E-30
sp|P54577|SYYC_HUMAN Tyrosine--tRNA ligase, cytoplasmic OS=Homo sapiens GN=YARS PE=1 SV=4 126 309 2.0E-29
sp|Q6TGS6|SYYC_DANRE Tyrosine--tRNA ligase, cytoplasmic OS=Danio rerio GN=yars PE=2 SV=2 103 302 4.0E-29
sp|Q20970|SYMC_CAEEL Methionine--tRNA ligase, cytoplasmic OS=Caenorhabditis elegans GN=mrs-1 PE=3 SV=1 164 300 1.0E-28
sp|Q5ZJ08|SYYC_CHICK Tyrosine--tRNA ligase, cytoplasmic OS=Gallus gallus GN=YARS PE=2 SV=1 126 309 3.0E-28
sp|Q8U221|SYM_PYRFU Methionine--tRNA ligase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=metG PE=3 SV=1 162 278 9.0E-14
sp|Q9V011|SYM_PYRAB Methionine--tRNA ligase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=metG PE=1 SV=1 164 278 1.0E-13
sp|B6YUN0|SYM_THEON Methionine--tRNA ligase OS=Thermococcus onnurineus (strain NA1) GN=metG PE=3 SV=1 164 278 2.0E-12
sp|O58721|SYM_PYRHO Methionine--tRNA ligase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=metG PE=3 SV=1 164 278 3.0E-12
sp|Q5JDZ7|SYM_THEKO Methionine--tRNA ligase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=metG PE=3 SV=1 164 278 3.0E-12
sp|Q1IDZ3|SYM_PSEE4 Methionine--tRNA ligase OS=Pseudomonas entomophila (strain L48) GN=metG PE=3 SV=1 131 278 5.0E-12
sp|Q48LT7|SYM_PSE14 Methionine--tRNA ligase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=metG PE=3 SV=1 146 278 8.0E-12
sp|Q4ZPK6|SYM_PSEU2 Methionine--tRNA ligase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=metG PE=3 SV=1 149 278 8.0E-12
sp|B1J1D1|SYM_PSEPW Methionine--tRNA ligase OS=Pseudomonas putida (strain W619) GN=metG PE=3 SV=1 155 278 9.0E-12
sp|Q73NT9|SYM_TREDE Methionine--tRNA ligase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=metG PE=3 SV=1 151 282 1.0E-11
sp|A5VZI8|SYM_PSEP1 Methionine--tRNA ligase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=metG PE=3 SV=2 131 278 1.0E-11
sp|Q88NV7|SYM_PSEPK Methionine--tRNA ligase OS=Pseudomonas putida (strain KT2440) GN=metG PE=3 SV=1 131 278 1.0E-11
sp|Q3K7L0|SYM_PSEPF Methionine--tRNA ligase OS=Pseudomonas fluorescens (strain Pf0-1) GN=metG PE=3 SV=1 129 278 2.0E-11
sp|O83776|SYM_TREPA Methionine--tRNA ligase OS=Treponema pallidum (strain Nichols) GN=metG PE=3 SV=1 119 277 2.0E-11
sp|B0KUD8|SYM_PSEPG Methionine--tRNA ligase OS=Pseudomonas putida (strain GB-1) GN=metG PE=3 SV=1 131 278 4.0E-11
sp|Q87XN0|SYM_PSESM Methionine--tRNA ligase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=metG PE=3 SV=1 149 278 5.0E-11
sp|A4FZL1|SYM_METM5 Methionine--tRNA ligase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=metG PE=3 SV=1 130 251 1.0E-10
sp|A8FWN7|SYM_SHESH Methionine--tRNA ligase OS=Shewanella sediminis (strain HAW-EB3) GN=metG PE=3 SV=1 107 278 2.0E-10
sp|A3D5E5|SYM_SHEB5 Methionine--tRNA ligase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=metG PE=3 SV=1 127 278 2.0E-10
sp|A9L4F6|SYM_SHEB9 Methionine--tRNA ligase OS=Shewanella baltica (strain OS195) GN=metG PE=3 SV=1 127 278 2.0E-10
sp|A6WP56|SYM_SHEB8 Methionine--tRNA ligase OS=Shewanella baltica (strain OS185) GN=metG PE=3 SV=1 127 278 3.0E-10
sp|Q4K758|SYM_PSEF5 Methionine--tRNA ligase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=metG PE=3 SV=1 164 278 4.0E-10
sp|B8E958|SYM_SHEB2 Methionine--tRNA ligase OS=Shewanella baltica (strain OS223) GN=metG PE=3 SV=1 127 278 4.0E-10
sp|A0L8S1|SYM_MAGMM Methionine--tRNA ligase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=metG PE=3 SV=1 164 278 5.0E-10
sp|A0KKF6|SYM_AERHH Methionine--tRNA ligase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=metG PE=3 SV=1 131 278 6.0E-10
sp|C1DEF4|SYM_AZOVD Methionine--tRNA ligase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=metG PE=3 SV=1 126 279 6.0E-10
sp|A6URW2|SYM_METVS Methionine--tRNA ligase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=metG PE=3 SV=1 128 255 7.0E-10
sp|P23395|SYM_THET8 Methionine--tRNA ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=metG PE=1 SV=2 164 252 7.0E-10
sp|A1SVA5|SYM_PSYIN Methionine--tRNA ligase OS=Psychromonas ingrahamii (strain 37) GN=metG PE=3 SV=1 149 278 8.0E-10
sp|A9FBU8|SYM1_SORC5 Methionine--tRNA ligase 1 OS=Sorangium cellulosum (strain So ce56) GN=metG1 PE=3 SV=1 158 279 9.0E-10
sp|Q74MZ1|SYM_NANEQ Methionine--tRNA ligase OS=Nanoarchaeum equitans (strain Kin4-M) GN=metG PE=3 SV=1 142 278 9.0E-10
sp|A6VIW5|SYM_METM7 Methionine--tRNA ligase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=metG PE=3 SV=1 24 251 1.0E-09
sp|Q0HVY2|SYM_SHESR Methionine--tRNA ligase OS=Shewanella sp. (strain MR-7) GN=metG PE=3 SV=1 135 278 1.0E-09
sp|Q6M0E5|SYM_METMP Methionine--tRNA ligase OS=Methanococcus maripaludis (strain S2 / LL) GN=metG PE=3 SV=1 130 251 2.0E-09
sp|Q0AES9|SYM_NITEC Methionine--tRNA ligase OS=Nitrosomonas eutropha (strain C91) GN=metG PE=3 SV=1 129 278 2.0E-09
sp|C3KBZ7|SYM_PSEFS Methionine--tRNA ligase OS=Pseudomonas fluorescens (strain SBW25) GN=metG PE=3 SV=1 129 278 2.0E-09
sp|A1RIY0|SYM_SHESW Methionine--tRNA ligase OS=Shewanella sp. (strain W3-18-1) GN=metG PE=3 SV=1 138 278 2.0E-09
sp|A4Y7K8|SYM_SHEPC Methionine--tRNA ligase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=metG PE=3 SV=1 138 278 2.0E-09
sp|A4XS54|SYM_PSEMY Methionine--tRNA ligase OS=Pseudomonas mendocina (strain ymp) GN=metG PE=3 SV=1 126 278 2.0E-09
sp|A4VJ05|SYM_PSEU5 Methionine--tRNA ligase OS=Pseudomonas stutzeri (strain A1501) GN=metG PE=3 SV=2 131 278 2.0E-09
sp|Q0HJN6|SYM_SHESM Methionine--tRNA ligase OS=Shewanella sp. (strain MR-4) GN=metG PE=3 SV=1 135 278 3.0E-09
sp|A0KW24|SYM_SHESA Methionine--tRNA ligase OS=Shewanella sp. (strain ANA-3) GN=metG PE=3 SV=1 135 278 3.0E-09
sp|C4LEX5|SYM_TOLAT Methionine--tRNA ligase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=metG PE=3 SV=1 139 278 3.0E-09
sp|Q1QVN7|SYM_CHRSD Methionine--tRNA ligase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=metG PE=3 SV=1 127 278 3.0E-09
sp|Q58659|SYM_METJA Methionine--tRNA ligase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=metG PE=3 SV=1 140 278 3.0E-09
sp|B1KQM2|SYM_SHEWM Methionine--tRNA ligase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=metG PE=3 SV=1 92 278 3.0E-09
sp|Q82WP0|SYM_NITEU Methionine--tRNA ligase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=metG PE=3 SV=1 164 278 4.0E-09
sp|Q8EDX2|SYM_SHEON Methionine--tRNA ligase OS=Shewanella oneidensis (strain MR-1) GN=metG PE=3 SV=1 135 278 4.0E-09
sp|B7VLW8|SYM_VIBTL Methionine--tRNA ligase OS=Vibrio tasmaniensis (strain LGP32) GN=metG PE=3 SV=1 162 278 4.0E-09
sp|Q87N07|SYM_VIBPA Methionine--tRNA ligase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=metG PE=3 SV=2 164 278 6.0E-09
sp|Q46F18|SYM_METBF Methionine--tRNA ligase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=metG PE=3 SV=1 129 278 8.0E-09
sp|A7MZT3|SYM_VIBCB Methionine--tRNA ligase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=metG PE=3 SV=2 164 278 8.0E-09
sp|B5FG53|SYM_VIBFM Methionine--tRNA ligase OS=Vibrio fischeri (strain MJ11) GN=metG PE=3 SV=1 164 278 1.0E-08
sp|Q0AAG6|SYM_ALKEH Methionine--tRNA ligase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=metG PE=3 SV=1 126 278 2.0E-08
sp|Q3JCG5|SYM_NITOC Methionine--tRNA ligase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=metG PE=3 SV=1 130 278 2.0E-08
sp|Q8D8F2|SYM_VIBVU Methionine--tRNA ligase OS=Vibrio vulnificus (strain CMCP6) GN=metG PE=3 SV=2 164 278 2.0E-08
sp|Q7MM14|SYM_VIBVY Methionine--tRNA ligase OS=Vibrio vulnificus (strain YJ016) GN=metG PE=3 SV=1 164 278 2.0E-08
sp|A1S798|SYM_SHEAM Methionine--tRNA ligase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=metG PE=3 SV=1 140 278 2.0E-08
sp|A3QD92|SYM_SHELP Methionine--tRNA ligase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=metG PE=3 SV=1 134 278 2.0E-08
sp|Q0VP51|SYM_ALCBS Methionine--tRNA ligase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=metG PE=3 SV=1 164 278 3.0E-08
sp|A4WCF6|SYM_ENT38 Methionine--tRNA ligase OS=Enterobacter sp. (strain 638) GN=metG PE=3 SV=2 140 278 3.0E-08
sp|Q8ZNN4|SYM_SALTY Methionine--tRNA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=metG PE=3 SV=3 140 278 3.0E-08
sp|B5FMX1|SYM_SALDC Methionine--tRNA ligase OS=Salmonella dublin (strain CT_02021853) GN=metG PE=3 SV=1 140 278 3.0E-08
sp|B6EIY5|SYM_ALISL Methionine--tRNA ligase OS=Aliivibrio salmonicida (strain LFI1238) GN=metG PE=3 SV=1 164 278 3.0E-08
sp|Q2Y7P0|SYM_NITMU Methionine--tRNA ligase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=metG PE=3 SV=1 164 278 3.0E-08
sp|B5BE81|SYM_SALPK Methionine--tRNA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=metG PE=3 SV=1 140 278 4.0E-08
sp|Q5PJ43|SYM_SALPA Methionine--tRNA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=metG PE=3 SV=1 140 278 4.0E-08
sp|Q8Z5C3|SYM_SALTI Methionine--tRNA ligase OS=Salmonella typhi GN=metG PE=3 SV=3 140 278 4.0E-08
sp|A9N7I2|SYM_SALPB Methionine--tRNA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=metG PE=3 SV=2 140 278 4.0E-08
sp|B4SXY7|SYM_SALNS Methionine--tRNA ligase OS=Salmonella newport (strain SL254) GN=metG PE=3 SV=1 140 278 4.0E-08
sp|B4T9X0|SYM_SALHS Methionine--tRNA ligase OS=Salmonella heidelberg (strain SL476) GN=metG PE=3 SV=1 140 278 4.0E-08
sp|B5EXZ5|SYM_SALA4 Methionine--tRNA ligase OS=Salmonella agona (strain SL483) GN=metG PE=3 SV=1 140 278 4.0E-08
sp|B5RBZ5|SYM_SALG2 Methionine--tRNA ligase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=metG PE=3 SV=1 140 278 4.0E-08
sp|B5R0E7|SYM_SALEP Methionine--tRNA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=metG PE=3 SV=1 140 278 4.0E-08
sp|Q57MI5|SYM_SALCH Methionine--tRNA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=metG PE=3 SV=2 140 278 4.0E-08
sp|Q5E3Z7|SYM_VIBF1 Methionine--tRNA ligase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=metG PE=3 SV=1 164 278 4.0E-08
sp|C0Q0Y1|SYM_SALPC Methionine--tRNA ligase OS=Salmonella paratyphi C (strain RKS4594) GN=metG PE=3 SV=1 140 278 5.0E-08
sp|Q9RUF3|SYM_DEIRA Methionine--tRNA ligase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=metG PE=3 SV=1 118 266 5.0E-08
sp|Q9HYC7|SYM_PSEAE Methionine--tRNA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=metG PE=3 SV=1 136 278 6.0E-08
sp|B7UWJ8|SYM_PSEA8 Methionine--tRNA ligase OS=Pseudomonas aeruginosa (strain LESB58) GN=metG PE=3 SV=1 136 278 6.0E-08
sp|B4TNL2|SYM_SALSV Methionine--tRNA ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=metG PE=3 SV=1 140 278 7.0E-08
sp|Q02QX1|SYM_PSEAB Methionine--tRNA ligase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=metG PE=3 SV=1 136 278 8.0E-08
sp|A8AEB2|SYM_CITK8 Methionine--tRNA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=metG PE=3 SV=1 140 278 9.0E-08
sp|Q31GU1|SYM_THICR Methionine--tRNA ligase OS=Thiomicrospira crunogena (strain XCL-2) GN=metG PE=3 SV=1 122 278 9.0E-08
sp|Q6LSZ7|SYM_PHOPR Methionine--tRNA ligase OS=Photobacterium profundum GN=metG PE=3 SV=1 164 278 9.0E-08
sp|A1KAG3|SYM_AZOSB Methionine--tRNA ligase OS=Azoarcus sp. (strain BH72) GN=metG PE=3 SV=1 139 278 2.0E-07
sp|A1TZ66|SYM_MARHV Methionine--tRNA ligase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=metG PE=3 SV=1 164 278 2.0E-07
sp|B5ENA8|SYM_ACIF5 Methionine--tRNA ligase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=metG PE=3 SV=1 162 278 2.0E-07
sp|B7J7Y5|SYM_ACIF2 Methionine--tRNA ligase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=metG PE=3 SV=1 162 278 2.0E-07
sp|A9MKV0|SYM_SALAR Methionine--tRNA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=metG PE=3 SV=2 143 278 2.0E-07
sp|B7J2F0|SYM_BORBZ Methionine--tRNA ligase OS=Borrelia burgdorferi (strain ZS7) GN=metG PE=3 SV=1 139 282 2.0E-07
sp|Q44951|SYM_BORBU Methionine--tRNA ligase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=metG PE=3 SV=2 139 282 2.0E-07
sp|A7MHL3|SYM_CROS8 Methionine--tRNA ligase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=metG PE=3 SV=2 140 278 2.0E-07
sp|A6V1U3|SYM_PSEA7 Methionine--tRNA ligase OS=Pseudomonas aeruginosa (strain PA7) GN=metG PE=3 SV=1 126 278 3.0E-07
sp|A1WUY7|SYM_HALHL Methionine--tRNA ligase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=metG PE=3 SV=1 105 278 3.0E-07
sp|A6TBK7|SYM_KLEP7 Methionine--tRNA ligase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=metG PE=3 SV=1 125 278 3.0E-07
sp|B5XP89|SYM_KLEP3 Methionine--tRNA ligase OS=Klebsiella pneumoniae (strain 342) GN=metG PE=3 SV=1 125 278 3.0E-07
sp|A2SRE2|SYM_METLZ Methionine--tRNA ligase OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=metG PE=3 SV=1 125 251 3.0E-07
sp|Q6MMA3|SYM_BDEBA Methionine--tRNA ligase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=metG PE=3 SV=1 164 278 7.0E-07
sp|B7NCE4|SYM_ECOLU Methionine--tRNA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=metG PE=3 SV=1 140 278 8.0E-07
sp|B7UFD1|SYM_ECO27 Methionine--tRNA ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=metG PE=3 SV=1 140 278 8.0E-07
sp|B1LN54|SYM_ECOSM Methionine--tRNA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=metG PE=3 SV=1 140 278 9.0E-07
sp|B6HYV5|SYM_ECOSE Methionine--tRNA ligase OS=Escherichia coli (strain SE11) GN=metG PE=3 SV=1 140 278 9.0E-07
sp|B7M4V9|SYM_ECO8A Methionine--tRNA ligase OS=Escherichia coli O8 (strain IAI1) GN=metG PE=3 SV=1 140 278 9.0E-07
sp|B7NPL8|SYM_ECO7I Methionine--tRNA ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=metG PE=3 SV=1 140 278 9.0E-07
sp|B5YV64|SYM_ECO5E Methionine--tRNA ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=metG PE=3 SV=1 140 278 9.0E-07
sp|Q8X7E7|SYM_ECO57 Methionine--tRNA ligase OS=Escherichia coli O157:H7 GN=metG PE=3 SV=3 140 278 9.0E-07
sp|B7L9Y6|SYM_ECO55 Methionine--tRNA ligase OS=Escherichia coli (strain 55989 / EAEC) GN=metG PE=3 SV=1 140 278 9.0E-07
sp|A7ZNT3|SYM_ECO24 Methionine--tRNA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=metG PE=3 SV=1 140 278 9.0E-07
sp|Q54X95|SYMC_DICDI Probable methionine--tRNA ligase, cytoplasmic OS=Dictyostelium discoideum GN=metS PE=3 SV=1 164 297 9.0E-07
sp|B1IYW7|SYM_ECOLC Methionine--tRNA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=metG PE=3 SV=1 140 278 9.0E-07
sp|A8A1X8|SYM_ECOHS Methionine--tRNA ligase OS=Escherichia coli O9:H4 (strain HS) GN=metG PE=3 SV=1 140 278 9.0E-07
sp|B7MX36|SYM_ECO81 Methionine--tRNA ligase OS=Escherichia coli O81 (strain ED1a) GN=metG PE=3 SV=1 140 278 9.0E-07
sp|P00959|SYM_ECOLI Methionine--tRNA ligase OS=Escherichia coli (strain K12) GN=metG PE=1 SV=2 140 278 9.0E-07
sp|B1X7K4|SYM_ECODH Methionine--tRNA ligase OS=Escherichia coli (strain K12 / DH10B) GN=metG PE=3 SV=1 140 278 9.0E-07
sp|C4ZSJ8|SYM_ECOBW Methionine--tRNA ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=metG PE=3 SV=1 140 278 9.0E-07
sp|B2TVX7|SYM_SHIB3 Methionine--tRNA ligase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=metG PE=3 SV=1 140 278 9.0E-07
sp|Q323B4|SYM_SHIBS Methionine--tRNA ligase OS=Shigella boydii serotype 4 (strain Sb227) GN=metG PE=3 SV=1 140 278 9.0E-07
sp|Q0TFX8|SYM_ECOL5 Methionine--tRNA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=metG PE=3 SV=2 140 278 9.0E-07
sp|Q32EI8|SYM_SHIDS Methionine--tRNA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=metG PE=3 SV=1 140 278 9.0E-07
sp|P57838|SYM_PASMU Methionine--tRNA ligase OS=Pasteurella multocida (strain Pm70) GN=metG PE=3 SV=1 145 278 1.0E-06
sp|Q3Z096|SYM_SHISS Methionine--tRNA ligase OS=Shigella sonnei (strain Ss046) GN=metG PE=3 SV=1 140 278 1.0E-06
sp|A8H3V2|SYM_SHEPA Methionine--tRNA ligase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=metG PE=3 SV=1 143 278 1.0E-06
sp|Q480H5|SYM_COLP3 Methionine--tRNA ligase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=metG PE=3 SV=1 164 278 1.0E-06
sp|Q5P239|SYM_AROAE Methionine--tRNA ligase OS=Aromatoleum aromaticum (strain EbN1) GN=metG PE=3 SV=1 140 278 1.0E-06
sp|B0TJ05|SYM_SHEHH Methionine--tRNA ligase OS=Shewanella halifaxensis (strain HAW-EB4) GN=metG PE=3 SV=1 164 278 1.0E-06
sp|Q64MP7|SYM_BACFR Methionine--tRNA ligase OS=Bacteroides fragilis (strain YCH46) GN=metG PE=3 SV=2 140 278 2.0E-06
sp|Q5L7I8|SYM_BACFN Methionine--tRNA ligase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=metG PE=3 SV=1 140 278 2.0E-06
sp|B1XWM2|SYM_LEPCP Methionine--tRNA ligase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=metG PE=3 SV=1 162 278 2.0E-06
sp|Q9KT69|SYM_VIBCH Methionine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=metG PE=3 SV=2 164 278 2.0E-06
sp|A5F2P8|SYM_VIBC3 Methionine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=metG PE=3 SV=2 164 278 2.0E-06
sp|Q47IK0|SYM_DECAR Methionine--tRNA ligase OS=Dechloromonas aromatica (strain RCB) GN=metG PE=3 SV=1 133 278 2.0E-06
sp|Q2SKU2|SYM_HAHCH Methionine--tRNA ligase OS=Hahella chejuensis (strain KCTC 2396) GN=metG PE=3 SV=1 164 278 2.0E-06
sp|A9R2M7|SYM_YERPG Methionine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=metG PE=3 SV=1 164 278 3.0E-06
sp|Q83KH0|SYM_SHIFL Methionine--tRNA ligase OS=Shigella flexneri GN=metG PE=3 SV=4 134 278 3.0E-06
sp|Q0T324|SYM_SHIF8 Methionine--tRNA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=metG PE=3 SV=1 134 278 3.0E-06
sp|B7LV75|SYM_ESCF3 Methionine--tRNA ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=metG PE=3 SV=1 134 278 3.0E-06
sp|A6UUN1|SYM_META3 Methionine--tRNA ligase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=metG PE=3 SV=1 164 278 3.0E-06
sp|Q1R9V8|SYM_ECOUT Methionine--tRNA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=metG PE=3 SV=2 140 278 3.0E-06
sp|Q8FFX8|SYM_ECOL6 Methionine--tRNA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=metG PE=3 SV=3 140 278 3.0E-06
sp|A1ACX8|SYM_ECOK1 Methionine--tRNA ligase OS=Escherichia coli O1:K1 / APEC GN=metG PE=3 SV=2 140 278 3.0E-06
sp|B7MEG9|SYM_ECO45 Methionine--tRNA ligase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=metG PE=3 SV=1 140 278 3.0E-06
sp|Q1H2F4|SYM_METFK Methionine--tRNA ligase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=metG1 PE=3 SV=1 144 278 4.0E-06
sp|A1WBH1|SYM_ACISJ Methionine--tRNA ligase OS=Acidovorax sp. (strain JS42) GN=metG PE=3 SV=1 164 279 4.0E-06
sp|Q8A3M1|SYM_BACTN Methionine--tRNA ligase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=metG PE=3 SV=1 134 278 4.0E-06
sp|Q7URP3|SYM_RHOBA Methionine--tRNA ligase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=metG PE=3 SV=1 164 279 4.0E-06
sp|P42589|YGJH_ECOLI tRNA-binding protein YgjH OS=Escherichia coli (strain K12) GN=ygjH PE=1 SV=1 164 278 4.0E-06
sp|Q15UM1|SYM_PSEA6 Methionine--tRNA ligase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=metG PE=3 SV=1 164 278 4.0E-06
sp|Q6FE36|SYM_ACIAD Methionine--tRNA ligase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=metG PE=3 SV=1 164 278 4.0E-06
sp|Q60CR0|SYM_METCA Methionine--tRNA ligase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=metG PE=3 SV=1 118 278 5.0E-06
sp|A4TKM9|SYM_YERPP Methionine--tRNA ligase OS=Yersinia pestis (strain Pestoides F) GN=metG PE=3 SV=1 164 278 6.0E-06
sp|Q1CGU4|SYM_YERPN Methionine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=metG PE=3 SV=1 164 278 6.0E-06
sp|Q8ZG01|SYM_YERPE Methionine--tRNA ligase OS=Yersinia pestis GN=metG PE=3 SV=1 164 278 6.0E-06
sp|Q1C9T8|SYM_YERPA Methionine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=metG PE=3 SV=1 164 278 6.0E-06
sp|A7FJJ6|SYM_YERP3 Methionine--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=metG PE=3 SV=1 164 278 6.0E-06
sp|B9MEX0|SYM_ACIET Methionine--tRNA ligase OS=Acidovorax ebreus (strain TPSY) GN=metG PE=3 SV=1 164 279 7.0E-06
sp|Q21I21|SYM_SACD2 Methionine--tRNA ligase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=metG PE=3 SV=1 164 278 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0000049 tRNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0003723 RNA binding No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4663
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4960
Ophiocordyceps australis map64 (Brazil) OphauB2|7200
Ophiocordyceps camponoti-floridani Ophcf2|06317
Ophiocordyceps camponoti-rufipedis Ophun1|7280 (this protein)
Ophiocordyceps kimflemingae Ophio5|953
Ophiocordyceps subramaniannii Hirsu2|9830

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7280
MALSTTTYTPPEQAEITRWLTTASDLASETSLLRTLNAHLASRTTLLGAKPSEADIAVYRAVAPVVKAWGVEERT
GEKGMPHVVRFVDYVQNAAVYGLEVGEGEKVQVDLEDVRFVPVDAGKMTLPDRTKAKPEAPTKKEKEKEKSKKAA
KPQPASTPLSPSLIDLRVGRILKATTHPDADSLYVSTIAMGDEAETEDSVNYENQICRTVCSGLNGLIPLSEMQN
RAVVVVCNLKPVKMRGVKSCAMVLAASPPGDDDHKGPVELVAPPEGAKPGQRVYFEGWGGAPEKLLNPKKKIWET
FQPGFTTTDGLEVAFDAGRVETLGKTGLGKLVTDDGGVCTVKSLKSAVVR*
Coding >Ophun1|7280
ATGGCCCTCTCAACAACAACATACACCCCCCCCGAACAAGCCGAAATCACCCGCTGGCTCACCACAGCTTCAGAC
CTCGCCTCCGAAACCTCCCTCCTCCGCACGCTCAACGCCCACCTCGCCAGCCGGACGACTCTCCTCGGCGCGAAG
CCTAGCGAAGCCGACATTGCCGTCTACCGCGCTGTCGCCCCCGTGGTGAAGGCGTGGGGGGTGGAGGAGCGGACG
GGGGAGAAGGGGATGCCGCATGTTGTTCGCTTCGTGGATTATGTTCAAAATGCGGCGGTTTATGGGCTGGAGGTT
GGGGAGGGGGAGAAGGTGCAGGTTGATCTTGAGGATGTGCGCTTCGTGCCGGTTGACGCGGGCAAGATGACTCTC
CCAGATCGAACCAAGGCCAAACCCGAAGCACCCACCAAGAAAGAAAAAGAAAAGGAAAAGTCCAAGAAAGCAGCA
AAGCCCCAACCAGCTTCAACGCCCCTCTCCCCATCCCTCATCGACCTCCGCGTCGGCCGCATCCTAAAGGCAACC
ACGCACCCAGACGCAGACTCCCTCTACGTCTCAACCATCGCCATGGGCGACGAGGCCGAAACGGAAGACAGCGTC
AACTACGAGAACCAAATCTGCCGCACCGTCTGCTCAGGCCTCAACGGTCTAATCCCCCTTTCCGAGATGCAGAAC
CGCGCCGTCGTCGTCGTCTGTAATCTCAAGCCTGTCAAGATGCGTGGTGTCAAGTCCTGCGCCATGGTGTTGGCT
GCGTCGCCCCCTGGGGATGATGATCATAAGGGGCCGGTTGAACTTGTCGCTCCGCCTGAGGGGGCCAAGCCTGGG
CAGCGCGTTTACTTTGAGGGGTGGGGGGGCGCGCCCGAGAAGTTGCTCAATCCTAAGAAGAAGATCTGGGAGACT
TTTCAGCCGGGCTTTACTACTACTGATGGGCTGGAGGTTGCCTTTGATGCTGGGAGGGTTGAGACGCTGGGCAAG
ACTGGGCTTGGGAAGCTTGTTACCGACGATGGGGGCGTCTGCACCGTCAAGTCGCTCAAGAGCGCCGTCGTCAGA
TAG
Transcript >Ophun1|7280
ATGGCCCTCTCAACAACAACATACACCCCCCCCGAACAAGCCGAAATCACCCGCTGGCTCACCACAGCTTCAGAC
CTCGCCTCCGAAACCTCCCTCCTCCGCACGCTCAACGCCCACCTCGCCAGCCGGACGACTCTCCTCGGCGCGAAG
CCTAGCGAAGCCGACATTGCCGTCTACCGCGCTGTCGCCCCCGTGGTGAAGGCGTGGGGGGTGGAGGAGCGGACG
GGGGAGAAGGGGATGCCGCATGTTGTTCGCTTCGTGGATTATGTTCAAAATGCGGCGGTTTATGGGCTGGAGGTT
GGGGAGGGGGAGAAGGTGCAGGTTGATCTTGAGGATGTGCGCTTCGTGCCGGTTGACGCGGGCAAGATGACTCTC
CCAGATCGAACCAAGGCCAAACCCGAAGCACCCACCAAGAAAGAAAAAGAAAAGGAAAAGTCCAAGAAAGCAGCA
AAGCCCCAACCAGCTTCAACGCCCCTCTCCCCATCCCTCATCGACCTCCGCGTCGGCCGCATCCTAAAGGCAACC
ACGCACCCAGACGCAGACTCCCTCTACGTCTCAACCATCGCCATGGGCGACGAGGCCGAAACGGAAGACAGCGTC
AACTACGAGAACCAAATCTGCCGCACCGTCTGCTCAGGCCTCAACGGTCTAATCCCCCTTTCCGAGATGCAGAAC
CGCGCCGTCGTCGTCGTCTGTAATCTCAAGCCTGTCAAGATGCGTGGTGTCAAGTCCTGCGCCATGGTGTTGGCT
GCGTCGCCCCCTGGGGATGATGATCATAAGGGGCCGGTTGAACTTGTCGCTCCGCCTGAGGGGGCCAAGCCTGGG
CAGCGCGTTTACTTTGAGGGGTGGGGGGGCGCGCCCGAGAAGTTGCTCAATCCTAAGAAGAAGATCTGGGAGACT
TTTCAGCCGGGCTTTACTACTACTGATGGGCTGGAGGTTGCCTTTGATGCTGGGAGGGTTGAGACGCTGGGCAAG
ACTGGGCTTGGGAAGCTTGTTACCGACGATGGGGGCGTCTGCACCGTCAAGTCGCTCAAGAGCGCCGTCGTCAGA
TAG
Gene >Ophun1|7280
ATGGCCCTCTCAACAACAACATACACCCCCCCCGAACAAGCCGAAATCACCCGCTGGCTCACCACAGCTTCAGAC
CTCGCCTCCGAAACCTCCCTCCTCCGCACGCTCAACGCCCACCTCGCCAGCCGGACGACTCTCCTCGGCGCGAAG
CCTAGCGAAGCCGACATTGCCGTCTACCGCGCTGTCGCCCCCGTGGTGAAGGCGTGGGGGGTGGAGGAGCGGACG
GGGGAGAAGGGGATGCCGCATGTTGTTCGCTTCGTGGATTATGTTCAAAATGCGGCGGTTTATGGGCTGGAGGTT
GGGGAGGGGGAGAAGGTGCAGGTTGATCTTGAGGATGTGCGCTTCGTGCCGGTTGACGCGGGCAAGATGACTCTC
CCAGATCGAACCAAGGCCAAACCCGAAGCACCCACCAAGAAAGAAAAAGAAAAGGAAAAGTCCAAGAAAGCAGCA
AAGCCCCAACCAGCTTCAACGCCCCTCTCCCCATCCCTCATCGACCTCCGCGTCGGCCGCATCCTAAAGGCAACC
ACGCACCCAGACGCAGACTCCCTCTACGTCTCAACCATCGCCATGGGCGACGAGGCCGAAACGGAAGACAGCGTC
AACTACGAGAACCAAATCTGCCGCACCGTCTGCTCAGGCCTCAACGGTCTAATCCCCCTTTCCGAGATGCAGAAC
CGCGCCGTCGTCGTCGTCTGTAATCTCAAGCCTGTCAAGATGCGTGGTGTCAAGTCCTGCGCCATGGTGTTGGCT
GCGTCGCCCCCTGGGGATGATGATCATAAGGGGCCGGTTGAACTTGTCGCTCCGCCTGAGGGGGCCAAGCCTGGG
CAGCGCGTTTACTTTGAGGGGTGGGGGGGCGCGCCCGAGAAGTTGCTCAATCCTAAGAAGAAGATCTGGGAGACT
TTTCAGCCGGGCTTTACTACTACTGATGGGCTGGAGGTTGCCTTTGATGCTGGGAGGGTTGAGACGCTGGGCAAG
ACTGGGCTTGGGAAGCTTGTTACCGACGATGGGGGCGTCTGCACCGTCAAGTCGCTCAAGAGCGCCGTCGTCAGA
TAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail