Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7272
Gene name
LocationContig_891:94..5989
Strand-
Gene length (bp)5895
Transcript length (bp)4575
Coding sequence length (bp)4575
Protein length (aa) 1525

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02714 RSN1_7TM Calcium-dependent channel, 7TM region, putative phosphate 2.5E-80 403 675
PF13967 RSN1_TM Late exocytosis, associated with Golgi transport 1.9E-41 31 181
PF14703 PHM7_cyt Cytosolic domain of 10TM putative phosphate transporter 1.3E-30 204 391
PF12621 PHM7_ext Extracellular tail, of 10TM putative phosphate transporter 2.1E-29 768 863

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q03516|RSN1_YEAST Uncharacterized protein RSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSN1 PE=1 SV=1 44 878 9.0E-158
sp|Q09766|YA7D_SCHPO Uncharacterized membrane protein C24H6.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.13 PE=1 SV=1 44 871 5.0E-137
sp|Q12252|PHM7_YEAST Phosphate metabolism protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHM7 PE=1 SV=1 27 715 8.0E-127
sp|Q09809|CSC1_SCHPO Calcium permeable stress-gated cation channel 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2G11.09 PE=3 SV=2 43 696 4.0E-38
sp|B5TYT3|CSCL7_ARATH CSC1-like protein At1g11960 OS=Arabidopsis thaliana GN=At1g11960 PE=2 SV=1 38 698 2.0E-37
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q03516|RSN1_YEAST Uncharacterized protein RSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSN1 PE=1 SV=1 44 878 9.0E-158
sp|Q09766|YA7D_SCHPO Uncharacterized membrane protein C24H6.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.13 PE=1 SV=1 44 871 5.0E-137
sp|Q12252|PHM7_YEAST Phosphate metabolism protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHM7 PE=1 SV=1 27 715 8.0E-127
sp|Q09809|CSC1_SCHPO Calcium permeable stress-gated cation channel 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2G11.09 PE=3 SV=2 43 696 4.0E-38
sp|B5TYT3|CSCL7_ARATH CSC1-like protein At1g11960 OS=Arabidopsis thaliana GN=At1g11960 PE=2 SV=1 38 698 2.0E-37
sp|Q9C8G5|CSCLD_ARATH CSC1-like protein ERD4 OS=Arabidopsis thaliana GN=ERD4 PE=2 SV=1 299 691 3.0E-35
sp|A9LIW2|CSC1L_BRAJU CSC1-like protein ERD4 OS=Brassica juncea GN=ERD4 PE=3 SV=2 300 697 4.0E-34
sp|Q9XEA1|CSCL5_ARATH Protein OSCA1 OS=Arabidopsis thaliana GN=OSCA1 PE=1 SV=1 82 698 1.0E-33
sp|F4HYR3|CSCL6_ARATH CSC1-like protein At1g62320 OS=Arabidopsis thaliana GN=At1g62320 PE=3 SV=2 82 698 1.0E-33
sp|Q07798|SPO75_YEAST Sporulation-specific protein 75 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPO75 PE=1 SV=1 351 696 3.0E-33
sp|Q8VZM5|CSCL3_ARATH CSC1-like protein At4g15430 OS=Arabidopsis thaliana GN=At4g15430 PE=2 SV=1 38 737 5.0E-33
sp|Q5XEZ5|CSC1_ARATH Calcium permeable stress-gated cation channel 1 OS=Arabidopsis thaliana GN=CSC1 PE=2 SV=1 38 736 8.0E-33
sp|Q9LVE4|CSCL4_ARATH CSC1-like protein At3g21620 OS=Arabidopsis thaliana GN=At3g21620 PE=2 SV=1 58 698 1.0E-32
sp|Q9SY14|CSCL2_ARATH CSC1-like protein At4g02900 OS=Arabidopsis thaliana GN=At4g02900 PE=3 SV=1 82 680 5.0E-32
sp|Q9FVQ5|CSCL1_ARATH CSC1-like protein At1g32090 OS=Arabidopsis thaliana GN=At1g32090 PE=1 SV=1 38 681 6.0E-29
sp|Q06538|CSC1_YEAST Calcium permeable stress-gated cation channel 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSC1 PE=1 SV=1 1 708 3.0E-24
sp|F4JCY2|CSCL8_ARATH CSC1-like protein At3g54510 OS=Arabidopsis thaliana GN=At3g54510 PE=2 SV=1 314 689 4.0E-23
sp|O43022|YGV8_SCHPO Uncharacterized protein C354.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC354.08c PE=3 SV=1 76 671 1.0E-18
sp|F4I248|CSCLB_ARATH CSC1-like protein At1g69450 OS=Arabidopsis thaliana GN=At1g69450 PE=2 SV=1 102 716 5.0E-16
sp|F4IBD7|CSCLA_ARATH CSC1-like protein RXW8 OS=Arabidopsis thaliana GN=RXW8 PE=2 SV=1 350 675 4.0E-14
sp|Q8GUH7|CSCLC_ARATH CSC1-like protein HYP1 OS=Arabidopsis thaliana GN=HYP1 PE=2 SV=1 98 699 2.0E-12
sp|Q94A87|CSCL9_ARATH CSC1-like protein At1g10090 OS=Arabidopsis thaliana GN=At1g10090 PE=1 SV=1 384 675 5.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.5

Transmembrane Domains

Domain # Start End Length
1 30 52 22
2 118 140 22
3 160 179 19
4 406 428 22
5 448 470 22
6 498 520 22
7 550 572 22
8 593 615 22
9 619 641 22
10 661 695 34
11 1264 1286 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7272
MVSFIDWLKENLSKGPDSDKKDSQPESISGMVATLVPTLIPALAFLLVFLFFRRSQRRFYAPRTYLGSLPHNERS
PDLPGGWLNWIVPFAKIPDVYALTHQGIDSYLFLRYLRVATTIALVSLLITWPILFPINATGGGTATQLGILSYS
NISLANKDRLYAHAFVAWLVYGFVLYMIMRECIFYINLRQAYLLTPQYSRRISSRTVLFTAVPTDYLDEARIRAM
FRNTVRRVWIVGQSDHLTEVVDERDKVAMKMEKAQVNLIKMVNKARVKAASKNPDVSVVPADADNVAARYVPDKK
RPSHRTGPLGLVGKKVDTIDWCRGELRRLIPEAQRGQEEWRAGKYDPVRAVFVEFETQADAQSAYQTLTHHRALR
MCPKVVGVKPSEVVWKSLEIPWWQVVIRRYAVYAFISALILFWAIPVAIIGLITQVNTLKQLPGLGWIGSIPAPI
LGVVSGLLPAVALSIVLSLVPVVMRWCAKLAGAPTLSRAELFTQNAYFAFQVIQVFLVQTVFSSGIAALLDIAAN
PSSISSILGQQLPTSSNFYISYFIVQGITVATGVVTQVIGLVVFRVLYKFLASTPRAMYTKWTTLTPVLWGSLMP
VYTNIVCISIIFSVIAPLMLFWSTLALFLFHLAYRYNILFVSQTAVDTQGLIYPRALKQLFTGIYLAEICMIGLF
AAVTAAGPAVLMAIFLVFTILFQITLFKNLNPLLYGLPRSVQATEHVIRTASRTEPDGTVKAGEDGKTATLSREQ
SHGSVAQKEARGKAIMRFFKPWRYARYETLRDMMPREEDLGFDRLYTEETEATAYLPPSVSRQPPTIWIPEDAAG
VSKQEIALTSKVISITDEGASLDDKNHIVWDTEGARPPVWDERVLSSASACGENTPNTTCHGRDTALVLSQSRLL
ALDYGSGAEFEAGSRLPSVGDDATPFADAKAVGAARAADGQLLVLAGDCRAASSPTVWTWDPDGRDREWVRGSVG
GGEGQDGVAPPMVMGATLAFSSTLAPVMDRPSIYSYGGVCFTDEDDDGFDENWQASGNYSKTMRRLTPDGDQGYV
VGTAAASSPRTAMAGFSLTALPTSATNTSGTVTQRASFVLLGGHTSTAFINMSTAAVWSLPEETWTYVSISGDAP
DSRSGHSCVVSADGRDLVVLGGWVGDERTVARPQLVVLRRGGSGAYSEWRWVSEMQRQGEEEGVFGHGAALLPGN
VMVVYGGRKIGHGQGEEDEMGLRFLNLSSMEWLSSYRYDRARMHVEPSAPELTGSGPSVRRLGLGLGLGLGLALI
LALLIALCAWTQHRRRRRHHRRQLRGHLDAQAHGIDTDAFSWRRKQAYGAVPARKPLPSEARFDAFMSPPGVIHP
ILEEVPASDDEVGDDEDPFASPARRLDPEVREWVEARVGTQGLLMLPREPSPDGHSPSSSSYNTARSAGFTALQA
EGPTLLPPRRNSSDSSEPSSPNKTRNSPPRRSWFGSLRRVFSVSESSSSPEPIRHRPSLDRATSDMGELLRRRQG
RGDWEEGGGGEWDIERAAERRRRF*
Coding >Ophun1|7272
ATGGTCTCCTTCATCGACTGGCTCAAGGAGAACTTGTCCAAGGGCCCAGACTCGGACAAGAAAGACTCCCAACCA
GAGTCCATCTCTGGCATGGTCGCAACCCTCGTCCCAACCCTGATTCCCGCCCTCGCCTTCTTGCTCGTCTTCCTC
TTCTTTCGCAGATCCCAGCGCAGATTCTACGCGCCCAGGACCTATCTCGGCTCCCTGCCTCACAATGAACGCAGC
CCTGACCTGCCTGGCGGCTGGCTCAACTGGATCGTCCCCTTTGCCAAGATACCCGACGTCTACGCCCTCACCCAT
CAAGGCATCGACTCGTATCTCTTCCTCCGATACCTACGCGTCGCCACCACCATCGCCCTTGTCAGCCTGCTCATC
ACCTGGCCCATCCTCTTCCCCATCAATGCCACTGGCGGCGGTACCGCGACCCAGCTTGGGATCCTCTCGTACAGC
AACATCAGCCTCGCCAACAAGGACCGCCTCTACGCCCACGCCTTTGTCGCATGGCTCGTCTACGGCTTCGTCCTC
TACATGATTATGCGAGAATGCATCTTCTACATCAACCTGCGACAGGCCTACCTCCTCACCCCCCAGTACTCCCGT
CGCATATCCTCCCGCACCGTTCTCTTCACCGCCGTGCCGACTGATTATCTCGACGAGGCTCGCATCCGCGCCATG
TTCCGCAACACGGTCCGCCGCGTCTGGATCGTCGGTCAGTCAGACCATCTGACGGAGGTGGTCGACGAGCGCGAC
AAGGTGGCCATGAAGATGGAAAAGGCCCAAGTCAACCTCATCAAGATGGTCAACAAGGCCCGCGTCAAGGCCGCC
AGCAAGAACCCCGACGTTTCTGTCGTCCCCGCCGACGCCGACAACGTTGCCGCTCGCTACGTGCCGGATAAGAAG
CGGCCCTCGCACCGCACGGGGCCCCTGGGACTCGTCGGCAAAAAGGTCGACACCATCGACTGGTGCCGCGGAGAG
CTCAGGAGGCTCATCCCCGAGGCTCAGCGTGGTCAGGAGGAGTGGCGCGCCGGCAAATACGACCCCGTCCGAGCC
GTCTTTGTCGAGTTTGAGACGCAGGCCGATGCCCAGTCCGCCTACCAGACCCTCACCCACCACCGCGCCCTTCGC
ATGTGCCCCAAAGTGGTCGGTGTCAAGCCCAGCGAGGTGGTGTGGAAGAGCCTCGAGATTCCCTGGTGGCAGGTC
GTCATCCGTCGCTACGCCGTCTACGCCTTCATCAGCGCCCTGATCCTCTTCTGGGCCATCCCCGTCGCCATCATC
GGCCTCATCACCCAGGTCAATACGCTGAAGCAGCTGCCCGGCCTCGGCTGGATCGGATCCATTCCCGCCCCCATC
CTCGGCGTCGTCTCGGGCCTCTTGCCGGCCGTGGCCTTGTCCATTGTCCTCTCGCTCGTGCCCGTCGTCATGCGA
TGGTGCGCCAAGCTCGCCGGTGCCCCGACGCTGTCTCGGGCCGAGCTCTTTACCCAAAACGCCTACTTCGCCTTT
CAGGTCATCCAGGTCTTCCTCGTCCAGACCGTCTTCAGCTCGGGCATCGCCGCCCTCCTGGACATCGCCGCCAAC
CCGTCGAGCATCTCTAGCATCCTGGGCCAGCAGCTGCCGACGTCGTCCAACTTTTACATTTCCTACTTTATCGTT
CAGGGCATCACCGTGGCCACTGGCGTCGTCACCCAGGTCATCGGCCTCGTCGTCTTCCGCGTCCTCTACAAGTTC
CTGGCCTCGACACCTCGCGCCATGTACACCAAGTGGACGACGCTGACGCCCGTGCTGTGGGGATCCCTGATGCCT
GTCTACACCAACATCGTCTGCATTAGCATCATCTTCTCCGTCATTGCGCCCCTGATGCTGTTCTGGTCGACGCTG
GCCCTGTTCCTCTTCCACCTGGCCTACCGCTACAACATCCTGTTCGTGTCGCAGACGGCCGTCGACACGCAGGGT
CTCATCTACCCGCGCGCGCTCAAGCAGCTGTTTACCGGCATTTACCTGGCAGAGATTTGCATGATCGGCCTCTTT
GCCGCCGTCACGGCTGCTGGACCGGCGGTGCTCATGGCCATCTTCCTCGTCTTCACCATCCTCTTCCAGATCACC
CTCTTCAAGAACCTGAACCCGCTGCTGTACGGACTGCCTCGCAGCGTGCAGGCGACGGAACACGTGATTCGCACC
GCCTCGAGGACGGAGCCCGACGGGACGGTCAAGGCGGGCGAGGACGGCAAGACGGCGACGCTTTCGAGGGAACAG
TCGCATGGCAGCGTGGCACAGAAGGAGGCCCGGGGCAAAGCCATCATGCGCTTCTTCAAGCCGTGGCGGTACGCG
CGGTACGAGACGCTGCGCGACATGATGCCGCGCGAAGAGGATCTCGGCTTCGACCGGCTGTACACGGAGGAGACG
GAAGCGACGGCATACCTCCCCCCGTCGGTCAGCCGACAGCCGCCGACGATATGGATCCCGGAAGACGCGGCGGGC
GTGTCGAAGCAGGAGATAGCGCTGACGAGCAAGGTGATATCCATTACGGACGAGGGGGCGTCTCTGGACGACAAG
AACCACATCGTGTGGGATACGGAGGGGGCTCGGCCGCCGGTGTGGGATGAGAGGGTCCTCAGCTCAGCATCAGCC
TGCGGCGAAAACACCCCCAACACAACCTGCCACGGCCGAGACACAGCCCTCGTCCTCTCCCAATCCCGCCTCCTC
GCCCTCGACTACGGATCCGGCGCCGAGTTCGAGGCCGGCTCCCGACTCCCCTCCGTCGGCGACGACGCGACTCCC
TTTGCCGATGCCAAGGCCGTGGGCGCCGCGAGGGCTGCTGACGGACAGCTGTTGGTCCTCGCGGGCGATTGTCGG
GCTGCGTCTTCGCCGACGGTCTGGACTTGGGATCCTGATGGGCGAGATAGGGAATGGGTGAGAGGTTCCGTCGGA
GGGGGGGAAGGACAAGATGGCGTTGCGCCTCCGATGGTCATGGGCGCGACGTTGGCGTTTTCATCTACGTTGGCG
CCTGTCATGGATCGGCCTTCGATATACTCGTACGGAGGCGTTTGCTTCACCGACGAGGATGACGATGGCTTCGAT
GAGAACTGGCAGGCCAGCGGCAACTACTCCAAGACGATGAGACGACTGACGCCAGACGGGGATCAAGGCTACGTC
GTCGGCACAGCAGCCGCGTCCTCGCCCCGAACAGCCATGGCAGGATTCAGCCTGACGGCCCTCCCAACCTCGGCG
ACCAACACGTCCGGAACGGTGACGCAGCGGGCCAGCTTCGTCCTCTTGGGCGGACACACGAGCACGGCCTTTATC
AACATGAGCACCGCAGCGGTATGGTCCCTCCCCGAAGAGACGTGGACGTACGTATCCATCAGCGGCGACGCGCCG
GATAGTCGCTCGGGACATAGCTGCGTCGTCAGCGCGGATGGGCGCGATCTCGTCGTCTTGGGCGGCTGGGTGGGA
GACGAGCGGACGGTGGCGAGGCCGCAGCTTGTTGTTCTCAGGAGGGGGGGCAGCGGTGCGTATAGCGAGTGGAGG
TGGGTGTCTGAGATGCAGAGGCAGGGGGAGGAGGAGGGTGTGTTTGGACATGGAGCTGCCTTGTTGCCTGGGAAT
GTCATGGTTGTCTACGGGGGGAGGAAGATTGGCCATGGTCAGGGGGAGGAGGATGAGATGGGGTTGCGGTTCCTG
AACCTGTCTTCCATGGAGTGGCTCTCTTCCTATCGCTATGATCGGGCCCGGATGCATGTGGAGCCCTCGGCCCCG
GAGCTGACCGGCAGCGGACCATCCGTTCGACGACTCGGGCTCGGACTCGGTCTCGGTCTCGGCCTGGCACTTATA
CTGGCCCTCCTCATCGCCCTCTGCGCCTGGACCCAGCATCGTCGTCGTCGTCGTCACCACCGCCGCCAGCTAAGA
GGCCATCTCGACGCCCAAGCCCACGGCATCGACACCGACGCCTTCTCCTGGCGCCGGAAGCAAGCCTACGGCGCC
GTCCCCGCCCGCAAGCCCCTGCCCTCGGAAGCCCGTTTCGACGCCTTCATGTCGCCCCCCGGCGTGATCCATCCG
ATCCTCGAGGAGGTTCCCGCGTCGGATGACGAGGTCGGGGATGACGAGGATCCGTTTGCTTCGCCGGCGAGGAGG
TTGGATCCCGAGGTCAGGGAGTGGGTTGAGGCTAGGGTCGGGACGCAGGGGTTGTTGATGCTGCCGCGGGAGCCT
TCGCCTGATGGTCACAGTCCTTCGTCCAGCAGCTACAACACCGCCCGTTCAGCCGGCTTTACCGCCCTCCAAGCC
GAAGGCCCGACTCTCCTCCCCCCTCGACGCAACTCGAGCGACTCGTCAGAGCCCTCGTCCCCCAACAAGACGCGC
AATTCCCCCCCGCGACGAAGCTGGTTCGGCTCCCTCCGGCGCGTCTTCTCCGTCTCAGAATCCTCCTCGTCCCCC
GAGCCCATCCGCCACAGACCCTCTCTCGACAGGGCAACCTCGGACATGGGCGAGCTGCTACGCCGGCGACAGGGG
AGGGGAGACTGGGAGGAAGGGGGAGGCGGGGAGTGGGACATTGAGAGGGCGGCGGAGCGCCGGCGGCGGTTCTGA
Transcript >Ophun1|7272
ATGGTCTCCTTCATCGACTGGCTCAAGGAGAACTTGTCCAAGGGCCCAGACTCGGACAAGAAAGACTCCCAACCA
GAGTCCATCTCTGGCATGGTCGCAACCCTCGTCCCAACCCTGATTCCCGCCCTCGCCTTCTTGCTCGTCTTCCTC
TTCTTTCGCAGATCCCAGCGCAGATTCTACGCGCCCAGGACCTATCTCGGCTCCCTGCCTCACAATGAACGCAGC
CCTGACCTGCCTGGCGGCTGGCTCAACTGGATCGTCCCCTTTGCCAAGATACCCGACGTCTACGCCCTCACCCAT
CAAGGCATCGACTCGTATCTCTTCCTCCGATACCTACGCGTCGCCACCACCATCGCCCTTGTCAGCCTGCTCATC
ACCTGGCCCATCCTCTTCCCCATCAATGCCACTGGCGGCGGTACCGCGACCCAGCTTGGGATCCTCTCGTACAGC
AACATCAGCCTCGCCAACAAGGACCGCCTCTACGCCCACGCCTTTGTCGCATGGCTCGTCTACGGCTTCGTCCTC
TACATGATTATGCGAGAATGCATCTTCTACATCAACCTGCGACAGGCCTACCTCCTCACCCCCCAGTACTCCCGT
CGCATATCCTCCCGCACCGTTCTCTTCACCGCCGTGCCGACTGATTATCTCGACGAGGCTCGCATCCGCGCCATG
TTCCGCAACACGGTCCGCCGCGTCTGGATCGTCGGTCAGTCAGACCATCTGACGGAGGTGGTCGACGAGCGCGAC
AAGGTGGCCATGAAGATGGAAAAGGCCCAAGTCAACCTCATCAAGATGGTCAACAAGGCCCGCGTCAAGGCCGCC
AGCAAGAACCCCGACGTTTCTGTCGTCCCCGCCGACGCCGACAACGTTGCCGCTCGCTACGTGCCGGATAAGAAG
CGGCCCTCGCACCGCACGGGGCCCCTGGGACTCGTCGGCAAAAAGGTCGACACCATCGACTGGTGCCGCGGAGAG
CTCAGGAGGCTCATCCCCGAGGCTCAGCGTGGTCAGGAGGAGTGGCGCGCCGGCAAATACGACCCCGTCCGAGCC
GTCTTTGTCGAGTTTGAGACGCAGGCCGATGCCCAGTCCGCCTACCAGACCCTCACCCACCACCGCGCCCTTCGC
ATGTGCCCCAAAGTGGTCGGTGTCAAGCCCAGCGAGGTGGTGTGGAAGAGCCTCGAGATTCCCTGGTGGCAGGTC
GTCATCCGTCGCTACGCCGTCTACGCCTTCATCAGCGCCCTGATCCTCTTCTGGGCCATCCCCGTCGCCATCATC
GGCCTCATCACCCAGGTCAATACGCTGAAGCAGCTGCCCGGCCTCGGCTGGATCGGATCCATTCCCGCCCCCATC
CTCGGCGTCGTCTCGGGCCTCTTGCCGGCCGTGGCCTTGTCCATTGTCCTCTCGCTCGTGCCCGTCGTCATGCGA
TGGTGCGCCAAGCTCGCCGGTGCCCCGACGCTGTCTCGGGCCGAGCTCTTTACCCAAAACGCCTACTTCGCCTTT
CAGGTCATCCAGGTCTTCCTCGTCCAGACCGTCTTCAGCTCGGGCATCGCCGCCCTCCTGGACATCGCCGCCAAC
CCGTCGAGCATCTCTAGCATCCTGGGCCAGCAGCTGCCGACGTCGTCCAACTTTTACATTTCCTACTTTATCGTT
CAGGGCATCACCGTGGCCACTGGCGTCGTCACCCAGGTCATCGGCCTCGTCGTCTTCCGCGTCCTCTACAAGTTC
CTGGCCTCGACACCTCGCGCCATGTACACCAAGTGGACGACGCTGACGCCCGTGCTGTGGGGATCCCTGATGCCT
GTCTACACCAACATCGTCTGCATTAGCATCATCTTCTCCGTCATTGCGCCCCTGATGCTGTTCTGGTCGACGCTG
GCCCTGTTCCTCTTCCACCTGGCCTACCGCTACAACATCCTGTTCGTGTCGCAGACGGCCGTCGACACGCAGGGT
CTCATCTACCCGCGCGCGCTCAAGCAGCTGTTTACCGGCATTTACCTGGCAGAGATTTGCATGATCGGCCTCTTT
GCCGCCGTCACGGCTGCTGGACCGGCGGTGCTCATGGCCATCTTCCTCGTCTTCACCATCCTCTTCCAGATCACC
CTCTTCAAGAACCTGAACCCGCTGCTGTACGGACTGCCTCGCAGCGTGCAGGCGACGGAACACGTGATTCGCACC
GCCTCGAGGACGGAGCCCGACGGGACGGTCAAGGCGGGCGAGGACGGCAAGACGGCGACGCTTTCGAGGGAACAG
TCGCATGGCAGCGTGGCACAGAAGGAGGCCCGGGGCAAAGCCATCATGCGCTTCTTCAAGCCGTGGCGGTACGCG
CGGTACGAGACGCTGCGCGACATGATGCCGCGCGAAGAGGATCTCGGCTTCGACCGGCTGTACACGGAGGAGACG
GAAGCGACGGCATACCTCCCCCCGTCGGTCAGCCGACAGCCGCCGACGATATGGATCCCGGAAGACGCGGCGGGC
GTGTCGAAGCAGGAGATAGCGCTGACGAGCAAGGTGATATCCATTACGGACGAGGGGGCGTCTCTGGACGACAAG
AACCACATCGTGTGGGATACGGAGGGGGCTCGGCCGCCGGTGTGGGATGAGAGGGTCCTCAGCTCAGCATCAGCC
TGCGGCGAAAACACCCCCAACACAACCTGCCACGGCCGAGACACAGCCCTCGTCCTCTCCCAATCCCGCCTCCTC
GCCCTCGACTACGGATCCGGCGCCGAGTTCGAGGCCGGCTCCCGACTCCCCTCCGTCGGCGACGACGCGACTCCC
TTTGCCGATGCCAAGGCCGTGGGCGCCGCGAGGGCTGCTGACGGACAGCTGTTGGTCCTCGCGGGCGATTGTCGG
GCTGCGTCTTCGCCGACGGTCTGGACTTGGGATCCTGATGGGCGAGATAGGGAATGGGTGAGAGGTTCCGTCGGA
GGGGGGGAAGGACAAGATGGCGTTGCGCCTCCGATGGTCATGGGCGCGACGTTGGCGTTTTCATCTACGTTGGCG
CCTGTCATGGATCGGCCTTCGATATACTCGTACGGAGGCGTTTGCTTCACCGACGAGGATGACGATGGCTTCGAT
GAGAACTGGCAGGCCAGCGGCAACTACTCCAAGACGATGAGACGACTGACGCCAGACGGGGATCAAGGCTACGTC
GTCGGCACAGCAGCCGCGTCCTCGCCCCGAACAGCCATGGCAGGATTCAGCCTGACGGCCCTCCCAACCTCGGCG
ACCAACACGTCCGGAACGGTGACGCAGCGGGCCAGCTTCGTCCTCTTGGGCGGACACACGAGCACGGCCTTTATC
AACATGAGCACCGCAGCGGTATGGTCCCTCCCCGAAGAGACGTGGACGTACGTATCCATCAGCGGCGACGCGCCG
GATAGTCGCTCGGGACATAGCTGCGTCGTCAGCGCGGATGGGCGCGATCTCGTCGTCTTGGGCGGCTGGGTGGGA
GACGAGCGGACGGTGGCGAGGCCGCAGCTTGTTGTTCTCAGGAGGGGGGGCAGCGGTGCGTATAGCGAGTGGAGG
TGGGTGTCTGAGATGCAGAGGCAGGGGGAGGAGGAGGGTGTGTTTGGACATGGAGCTGCCTTGTTGCCTGGGAAT
GTCATGGTTGTCTACGGGGGGAGGAAGATTGGCCATGGTCAGGGGGAGGAGGATGAGATGGGGTTGCGGTTCCTG
AACCTGTCTTCCATGGAGTGGCTCTCTTCCTATCGCTATGATCGGGCCCGGATGCATGTGGAGCCCTCGGCCCCG
GAGCTGACCGGCAGCGGACCATCCGTTCGACGACTCGGGCTCGGACTCGGTCTCGGTCTCGGCCTGGCACTTATA
CTGGCCCTCCTCATCGCCCTCTGCGCCTGGACCCAGCATCGTCGTCGTCGTCGTCACCACCGCCGCCAGCTAAGA
GGCCATCTCGACGCCCAAGCCCACGGCATCGACACCGACGCCTTCTCCTGGCGCCGGAAGCAAGCCTACGGCGCC
GTCCCCGCCCGCAAGCCCCTGCCCTCGGAAGCCCGTTTCGACGCCTTCATGTCGCCCCCCGGCGTGATCCATCCG
ATCCTCGAGGAGGTTCCCGCGTCGGATGACGAGGTCGGGGATGACGAGGATCCGTTTGCTTCGCCGGCGAGGAGG
TTGGATCCCGAGGTCAGGGAGTGGGTTGAGGCTAGGGTCGGGACGCAGGGGTTGTTGATGCTGCCGCGGGAGCCT
TCGCCTGATGGTCACAGTCCTTCGTCCAGCAGCTACAACACCGCCCGTTCAGCCGGCTTTACCGCCCTCCAAGCC
GAAGGCCCGACTCTCCTCCCCCCTCGACGCAACTCGAGCGACTCGTCAGAGCCCTCGTCCCCCAACAAGACGCGC
AATTCCCCCCCGCGACGAAGCTGGTTCGGCTCCCTCCGGCGCGTCTTCTCCGTCTCAGAATCCTCCTCGTCCCCC
GAGCCCATCCGCCACAGACCCTCTCTCGACAGGGCAACCTCGGACATGGGCGAGCTGCTACGCCGGCGACAGGGG
AGGGGAGACTGGGAGGAAGGGGGAGGCGGGGAGTGGGACATTGAGAGGGCGGCGGAGCGCCGGCGGCGGTTCTGA
Gene >Ophun1|7272
ATGGTCTCCTTCATCGACTGGCTCAAGGAGAACTTGTCCAAGGGCCCAGACTCGGACAAGAAAGACTCCCAACCA
GAGTCCATCTCTGGTGAGTCTGCCTCGCTCGCCTCTTGTCGCTGCTCACCGTCACTGACTCTCTCTCTCTCTCTC
TCTCTCTCAAGGCATGGTCGCAACCCTCGTCCCAACCCTGATTCCCGCCCTCGCCTTCTTGCTCGTCTTCCTCTT
CTTTCGCAGATCCCAGCGCAGATTCTACGCGCCCAGGACCTATCTCGGCTCCCTGCCTCACAAGTGAGTCGTCAT
CACCGTCTGTCTCTGTCACCTCTAACCGTCCATCTCCAGTGAACGCAGCCCTGACCTGCCTGGCGGCTGGCTCAA
CTGGATCGTCCCCTTTGCCAAGATACCCGACGTCTACGCCCTCACCCATCAAGGCATCGACTCGTATCTCTTCCT
CCGATACCTACGCGTCGCCACCACCATCGCCCTTGTCAGCCTGCTCATCACCTGGCCCATCCTCTTCCCCATCAA
TGCCACTGGCGGCGGTACCGCGACCCAGCTTGGGATCCTCTCGTACAGCAACATCAGCCTCGCCAACAAGGACCG
CCTCTACGCCCACGCCTTTGTCGCATGGCTCGTCTACGGCTTCGTCCTCTACATGATTATGCGAGAATGCATCTT
CTACATCAACCTGCGACAGGCCTACCTCCTCACCCCCCAGTACTCCCGTCGCATATCCTCCCGCACCGTTCTCTT
CACCGCCGTGCCGACTGATTATCTCGACGAGGCTCGCATCCGCGCCATGTTCCGCAACACGGTCCGCCGCGTCTG
GATCGTCGGTCAGTCAGACCATCTGACGGAGGTGGTCGACGAGCGCGACAAGGTGGCCATGAAGATGGAAAAGGC
CCAAGTCAACCTCATCAAGATGGTCAACAAGGCCCGCGTCAAGGCCGCCAGCAAGAACCCCGACGTTTCTGTCGT
CCCCGCCGACGCCGACAACGTTGCCGCTCGCTACGTGCCGGATAAGAAGCGGCCCTCGCACCGCACGGGGCCCCT
GGGACTCGTCGGCAAAAAGGTCGACACCATCGACTGGTGCCGCGGAGAGCTCAGGAGGCTCATCCCCGAGGCTCA
GCGTGGTCAGGAGGAGTGGCGCGCCGGCAAATACGACCCCGTCCGAGCCGTCTTTGTCGAGTTTGAGACGCAGGC
CGATGCCCAGTCCGCCTACCAGACCCTCACCCACCACCGCGCCCTTCGCATGTGCCCCAAAGTGGTCGGTGTCAA
GCCCAGCGAGGTGGTGTGGAAGAGCCTCGAGATTCCCTGGTGGCAGGTCGTCATCCGTCGCTACGCCGTCTACGC
CTTCATCAGCGCCCTGATCCTCTTCTGGGCCATCCCCGTCGCCATCATCGGCCTCATCACCCAGGTCAATACGCT
GAAGCAGCTGCCCGGCCTCGGCTGGATCGGATCCATTCCCGCCGTGAGTCGTCGTCCCTTCTCTCAATGTCTGGC
TCTACTGACGCCCCTGTCCTCAGCCCATCCTCGGCGTCGTCTCGGGCCTCTTGCCGGCCGTGGCCTTGTCCATTG
TCCTCTCGCTCGTGCCCGTCGTCATGCGATGGTGCGCCAAGCTCGCCGGTGCCCCGACGCTGTCTCGGGCCGAGC
TCTTTACCCAAAACGCCTACTTCGCCTTTCAGGTCATCCAGGTCTTCCTCGTCCAGACCGTCTTCAGCTCGGGCA
TCGCCGCCCTCCTGGACATCGCCGCCAACCCGTCGAGCATCTCTAGCATCCTGGGCCAGCAGCTGCCGACGTCGT
CCAACTTTTACATTTCCTACTTTATCGTTCAGGGCATCACCGTGGCCACTGGCGTCGTCACCCAGGTCATCGGCC
TCGTCGTCTTCCGCGTCCTCTACAAGTTCCTGGCCTCGACACCTCGCGCCATGTACACCAAGTGGACGACGCTGA
CGCCCGTGCTGTGGGGATCCCTGATGCCTGTCTACACCAACATCGTCTGCATTAGTGAGTGGCCCGTGATCCCTT
GGCTCGTTGGGTGCTAACGACGACTACCCAGGCATCATCTTCTCCGTCATTGCGCCCCTGATGCTGTTCTGGTCG
ACGCTGGCCCTGTTCCTCTTCCACCTGGCCTACCGCTACAACATCCTGTTCGTGTCGCAGACGGCCGTCGACACG
CAGGGTCTCATCTACCCGCGCGCGCTCAAGCAGCTGTTTACCGGCATTTACCTGGCAGAGATTTGCATGATCGGC
CTCTTTGCCGCCGTCACGGCTGCTGGACCGGCGGTGCTCATGGCCATCTTCCTCGTCTTCACCATCCTCTTCCAG
ATCACCCTCTTCAAGAACCTGAACCCGCTGCTGTACGGACTGCCTCGCAGCGTGCAGGCGACGGAACACGTGATT
CGCACCGCCTCGAGGACGGAGCCCGACGGGACGGTCAAGGCGGGCGAGGACGGCAAGACGGCGACGCTTTCGAGG
GAACAGTCGCATGGCAGCGTGGCACAGAAGGAGGCCCGGGGCAAAGCCATCATGCGCTTCTTCAAGCCGTGGCGG
TACGCGCGGTACGAGACGCTGCGCGACATGATGCCGCGCGAAGAGGATCTCGGCTTCGACCGGCTGTACACGGAG
GAGACGGAAGCGACGGCATACCTCCCCCCGTCGGTCAGCCGACAGCCGCCGACGATATGGATCCCGGAAGACGCG
GCGGGCGTGTCGAAGCAGGAGATAGCGCTGACGAGCAAGGTGATATCCATTACGGACGAGGGGGCGTCTCTGGAC
GACAAGAACCACATCGTGTGGGATACGGAGGGGGCTCGGCCGCCGGTGTGGGATGAGAGGGTATATTATTGAGGA
GAGTAATTGTGTACAAGGCATCCCGTCCGCTTGGAGACGAGACGAGTTCTACCTATGGTCTGTATGGACAAGAGG
CACCTATATCCGGTCAATACTTTAATTACAAGATTTTACATATTCGTACAAACAAGTGTGATGGTGACGGGGGTG
TTGATAAAGACAGAGCCTGAATAGGATCTCTGCTGAGACTCTGTAGGAAGCATCCATCCAACGTTTGAAGATATC
CAACGTTGGCTGCGGTCAAGGAAGGGCTAAGTAATCGAAACCCCCCCCCCATCACCGTGGCAACGAGCCGCAACC
AAGAAAAACAAGCCCAAAAGCTAAAAAAGAAAAAACGGGCGCGTGTGAATGGTCAATGGATGGGGGGCGTTTTGC
ACGTGTAGCGCGGAGGAGCTGAGGTAGGACAGGCAGAAGAGAGGGGGGCAAACTTGGCGGTTGGGTGCGTGATTT
GGGGGAAGTGTTGGGCTGGTCCATAGGTTTGAGAGGTGGGCTTTGTTCTGGGGTGCTTGAGTGGTCTTTGCTTAT
GTACTTCAGTGGTTGAGGGATGGTGTTTGTGTTTGGAAGGGTTTGAGGGTGTTGAGCTGTTGTCTACGGCTTGTT
GCTGATTGCGAGTTCGGGCTCTTCTCTACCATCTATCGCGACTCTTCTTTTGCATCCGTTACGACTCTCCGTTTA
CATCCATCGCGACTCTTCTTTGACCTCCATCACGACTCTTTGTTTACGACCATCACAACCCTCGTCTCTCCTCTT
CACAACCCATCACGACTCTCTTCTCTCCCCCCCCCCCTGTCATGCCATCGACTGTCCCCTAACCCGACATGCCTC
ACGCAACCACGCAGGTCCTCAGCTCAGCATCAGCCTGCGGCGAAAACACCCCCAACACAACCTGCCACGGCCGAG
ACACAGCCCTCGTCCTCTCCCAATCCCGCCTCCTCGCCCTCGACTACGGATCCGGCGCCGAGTTCGAGGCCGGCT
CCCGACTCCCCTCCGTCGGCGACGACGCGACTCCCTTTGCCGATGCCAAGGCCGTGGGCGCCGCGAGGGCTGCTG
ACGGACAGCTGTTGGTCCTCGCGGGCGATTGTCGGGCTGCGTCTTCGCCGACGGTCTGGACTTGGGATCCTGATG
GGCGAGATAGGGAATGGGTGAGAGGTTCCGTCGGAGGGGGGGAAGGACAAGATGGCGTTGCGCCTCCGATGGTCA
TGGGCGCGACGTTGGCGTTTTCATCTACGTTGGCGCCTGTCATGGATCGGCCTTCGATATACTCGTACGGAGGCG
TTTGCTTCACCGACGAGGATGACGATGGCTTCGATGAGAACTGGCAGGCCAGCGGCAACTACTCCAAGACGATGA
GACGACTGACGCCAGACGGGGATCAAGGCTACGTCGTCGGCACAGCAGCCGCGTCCTCGCCCCGAACAGCCATGG
CAGGATTCAGCCTGACGGCCCTCCCAACCTCGGCGACCAACACGTCCGGAACGGTGACGCAGCGGGCCAGCTTCG
TCCTCTTGGGCGGACACACGAGCACGGCCTTTATCAACATGAGCACCGCAGCGGTATGGTCCCTCCCCGAAGAGA
CGTGGACGTACGTATCCATCAGCGGCGACGCGCCGGATAGTCGCTCGGGACATAGCTGCGTCGTCAGCGCGGATG
GGCGCGATCTCGTCGTCTTGGGCGGCTGGGTGGGAGACGAGCGGACGGTGGCGAGGCCGCAGCTTGTTGTTCTCA
GGAGGGGGGGCAGCGGTGCGTATAGCGAGTGGAGGTGGGTGTCTGAGATGCAGAGGCAGGGGGAGGAGGAGGGTG
TGTTTGGACATGGAGCTGCCTTGTTGCCTGGGAATGTCATGGTTGTCTACGGGGGGAGGAAGATTGGCCATGGTC
AGGGGGAGGAGGATGAGATGGGGTTGCGGTTCCTGAACCTGTCTTCCATGGAGTGGCTCTCTTCCTATCGCTATG
ATCGGGCCCGGATGCATGTGGAGCCCTCGGCCCCGGAGCTGACCGGCAGCGGACCATCCGTTCGACGACTCGGGC
TCGGACTCGGTCTCGGTCTCGGCCTGGCACTTATACTGGCCCTCCTCATCGCCCTCTGCGCCTGGACCCAGCATC
GTCGTCGTCGTCGTCACCACCGCCGCCAGCTAAGAGGCCATCTCGACGCCCAAGCCCACGGCATCGACACCGACG
CCTTCTCCTGGCGCCGGAAGCAAGCCTACGGCGCCGTCCCCGCCCGCAAGCCCCTGCCCTCGGAAGCCCGTTTCG
ACGCCTTCATGTCGCCCCCCGGCGTGATCCATCCGATCCTCGAGGAGGTTCCCGCGTCGGATGACGAGGTCGGGG
ATGACGAGGATCCGTTTGCTTCGCCGGCGAGGAGGTTGGATCCCGAGGTCAGGGAGTGGGTTGAGGCTAGGGTCG
GGACGCAGGGGTTGTTGATGCTGCCGCGGGAGCCTTCGCCTGATGGTCACAGTCCTTCGTCCAGCAGCTACAACA
CCGCCCGTTCAGCCGGCTTTACCGCCCTCCAAGCCGAAGGCCCGACTCTCCTCCCCCCTCGACGCAACTCGAGCG
ACTCGTCAGAGCCCTCGTCCCCCAACAAGACGCGCAATTCCCCCCCGCGACGAAGCTGGTTCGGCTCCCTCCGGC
GCGTCTTCTCCGTCTCAGAATCCTCCTCGTCCCCCGAGCCCATCCGCCACAGACCCTCTCTCGACAGGGCAACCT
CGGACATGGGCGAGCTGCTACGCCGGCGACAGGGGAGGGGAGACTGGGAGGAAGGGGGAGGCGGGGAGTGGGACA
TTGAGAGGGCGGCGGAGCGCCGGTCTGTGCAGGTCATGTTCACGGTTCCCAGGGAGAGGCTGCGGGTTGTCAACG
GGGGGGGGGACGAGGAGGAAGGGGGGGACGAGGTTCATCGGCCGCAGGTTGCCGAGCTGGTTGATCCGGAGCTTT
CTTTTGAGCCGTCCGAGGGGGGGGAGGTGGACGGCCGGCGCATGTCTCTGGGGGAGACGACGGGCGTGTCTTTGG
GGGGGAGGCCTTTGAGTTGGAGGCTTTCGCAGGCGGCGGTTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail