Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7269
Gene name
LocationContig_890:1963..2509
Strand-
Gene length (bp)546
Transcript length (bp)546
Coding sequence length (bp)546
Protein length (aa) 182

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05207 zf-CSL CSL zinc finger 5.7E-17 112 171
PF00226 DnaJ DnaJ domain 2.6E-12 17 89

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I7G0|DPH4_GIBZE Diphthamide biosynthesis protein 4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DPH4 PE=3 SV=2 15 177 1.0E-60
sp|Q7SEK8|DPH4_NEUCR Diphthamide biosynthesis protein 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dph-4 PE=3 SV=1 17 172 6.0E-35
sp|P0C0V5|DPH4_EMENI Diphthamide biosynthesis protein 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dph4 PE=3 SV=1 8 175 5.0E-32
sp|Q4WPF7|DPH4_ASPFU Diphthamide biosynthesis protein 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dph4 PE=3 SV=1 37 176 5.0E-30
sp|Q6C6T1|DPH4_YARLI Diphthamide biosynthesis protein 4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DPH4 PE=3 SV=1 17 175 5.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I7G0|DPH4_GIBZE Diphthamide biosynthesis protein 4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DPH4 PE=3 SV=2 15 177 1.0E-60
sp|Q7SEK8|DPH4_NEUCR Diphthamide biosynthesis protein 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dph-4 PE=3 SV=1 17 172 6.0E-35
sp|P0C0V5|DPH4_EMENI Diphthamide biosynthesis protein 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dph4 PE=3 SV=1 8 175 5.0E-32
sp|Q4WPF7|DPH4_ASPFU Diphthamide biosynthesis protein 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dph4 PE=3 SV=1 37 176 5.0E-30
sp|Q6C6T1|DPH4_YARLI Diphthamide biosynthesis protein 4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DPH4 PE=3 SV=1 17 175 5.0E-19
sp|Q6BPC1|DPH4_DEBHA Diphthamide biosynthesis protein 4 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DPH4 PE=3 SV=1 10 177 1.0E-17
sp|Q6FWM1|DPH4_CANGA Diphthamide biosynthesis protein 4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DPH4 PE=3 SV=1 17 177 6.0E-17
sp|P47138|DPH4_YEAST Diphthamide biosynthesis protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=JJJ3 PE=1 SV=1 11 177 6.0E-17
sp|Q5AD49|DPH4_CANAL Diphthamide biosynthesis protein 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=JJJ3 PE=3 SV=1 17 170 2.0E-16
sp|Q9UUG3|DPH4_SCHPO Diphthamide biosynthesis protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dph4 PE=3 SV=1 17 176 5.0E-16
sp|Q752D7|DPH4_ASHGO Diphthamide biosynthesis protein 4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DPH4 PE=3 SV=1 16 173 1.0E-15
sp|Q6CUQ9|DPH4_KLULA Diphthamide biosynthesis protein 4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DPH4 PE=3 SV=1 17 175 4.0E-10
sp|Q6P3W2|DJC24_HUMAN DnaJ homolog subfamily C member 24 OS=Homo sapiens GN=DNAJC24 PE=1 SV=1 19 170 4.0E-08
sp|Q9UXR9|DNAJ_METTE Chaperone protein DnaJ OS=Methanosarcina thermophila GN=dnaJ PE=3 SV=1 15 89 2.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4590
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5253
Ophiocordyceps australis map64 (Brazil) OphauB2|7652
Ophiocordyceps camponoti-floridani Ophcf2|00417
Ophiocordyceps camponoti-rufipedis Ophun1|7269 (this protein)
Ophiocordyceps kimflemingae Ophio5|6338
Ophiocordyceps subramaniannii Hirsu2|9634

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7269
MSAPSDATTDATTKTATHYEVLGLSPSMLDAVAQDPSQLIKQAYRRTLLRNHPDKTASASSPREPIYTVDQISHA
FAVLASPTRRAEYDASLRLALPAPGPGPTRFQTGVEMVDLDDLAFDDDRGRWYRPCRCGNDRGYSFDEADLADAA
DDGLLMVGCLDCSLWLSVHFAAVDDDELRPK*
Coding >Ophun1|7269
ATGTCCGCTCCTTCTGATGCCACCACCGATGCAACAACGAAAACAGCCACTCACTATGAAGTTCTCGGCCTCTCC
CCCTCGATGCTCGACGCCGTCGCCCAAGATCCCTCACAGCTGATCAAGCAAGCGTATCGCCGCACCCTTCTCCGC
AACCACCCCGACAAGACAGCCAGCGCCAGCTCTCCTCGAGAGCCAATCTATACGGTCGACCAAATAAGCCACGCC
TTCGCCGTCCTCGCCTCGCCCACCCGTCGCGCCGAATATGACGCCTCCCTCCGCCTCGCCTTACCCGCTCCCGGC
CCCGGCCCGACCCGCTTTCAGACCGGCGTGGAGATGGTCGACCTCGATGACTTGGCCTTCGACGACGACCGAGGA
CGCTGGTACCGCCCCTGTCGCTGCGGCAACGACAGGGGTTACTCCTTCGACGAGGCTGACCTGGCTGACGCCGCC
GACGACGGCCTGCTCATGGTTGGCTGCCTCGACTGCAGCCTCTGGCTAAGCGTGCACTTTGCCGCCGTCGATGAC
GACGAGCTGCGTCCGAAATGA
Transcript >Ophun1|7269
ATGTCCGCTCCTTCTGATGCCACCACCGATGCAACAACGAAAACAGCCACTCACTATGAAGTTCTCGGCCTCTCC
CCCTCGATGCTCGACGCCGTCGCCCAAGATCCCTCACAGCTGATCAAGCAAGCGTATCGCCGCACCCTTCTCCGC
AACCACCCCGACAAGACAGCCAGCGCCAGCTCTCCTCGAGAGCCAATCTATACGGTCGACCAAATAAGCCACGCC
TTCGCCGTCCTCGCCTCGCCCACCCGTCGCGCCGAATATGACGCCTCCCTCCGCCTCGCCTTACCCGCTCCCGGC
CCCGGCCCGACCCGCTTTCAGACCGGCGTGGAGATGGTCGACCTCGATGACTTGGCCTTCGACGACGACCGAGGA
CGCTGGTACCGCCCCTGTCGCTGCGGCAACGACAGGGGTTACTCCTTCGACGAGGCTGACCTGGCTGACGCCGCC
GACGACGGCCTGCTCATGGTTGGCTGCCTCGACTGCAGCCTCTGGCTAAGCGTGCACTTTGCCGCCGTCGATGAC
GACGAGCTGCGTCCGAAATGA
Gene >Ophun1|7269
ATGTCCGCTCCTTCTGATGCCACCACCGATGCAACAACGAAAACAGCCACTCACTATGAAGTTCTCGGCCTCTCC
CCCTCGATGCTCGACGCCGTCGCCCAAGATCCCTCACAGCTGATCAAGCAAGCGTATCGCCGCACCCTTCTCCGC
AACCACCCCGACAAGACAGCCAGCGCCAGCTCTCCTCGAGAGCCAATCTATACGGTCGACCAAATAAGCCACGCC
TTCGCCGTCCTCGCCTCGCCCACCCGTCGCGCCGAATATGACGCCTCCCTCCGCCTCGCCTTACCCGCTCCCGGC
CCCGGCCCGACCCGCTTTCAGACCGGCGTGGAGATGGTCGACCTCGATGACTTGGCCTTCGACGACGACCGAGGA
CGCTGGTACCGCCCCTGTCGCTGCGGCAACGACAGGGGTTACTCCTTCGACGAGGCTGACCTGGCTGACGCCGCC
GACGACGGCCTGCTCATGGTTGGCTGCCTCGACTGCAGCCTCTGGCTAAGCGTGCACTTTGCCGCCGTCGATGAC
GACGAGCTGCGTCCGAAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail