Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7264
Gene name
LocationContig_89:28761..33152
Strand+
Gene length (bp)4391
Transcript length (bp)3351
Coding sequence length (bp)3351
Protein length (aa) 1117

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O94248|MDN1_SCHPO Midasin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mdn1 PE=1 SV=1 673 927 1.0E-06

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 19 0.999769

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6910
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|06985
Ophiocordyceps camponoti-floridani Ophcf2|06986
Ophiocordyceps camponoti-rufipedis Ophun1|7264 (this protein)
Ophiocordyceps kimflemingae Ophio5|5709

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7264
MHYPLLLAALAVLQPGTHGLPITEDEPLYCEPSASIQDAEANIQSDGTNIGLTGPQASLLVTKGAESAGLSPEVV
QKLALTAEKGIGSADEFVKVVGAVSVSAIASASGKTSPVVRAMGAIEGLVIANMGDSPASRNVMAAAVAAASSGE
DQEVVTNITENTAKAAMNHEDDANLIMNEASQGCRSKRCRVSVKTVIQLISSGFSVKTALTVCAAVNSAAKYVIE
LESYAKVLVQQVSHLEKGVKPGQAARSAVEAKTSLGNATQAAQDVEKTMLGTAREIEDLPSPDMSVLADVAAKDD
QSTEVSTFSSTQTTMPASVAETAETSSPATLEDSTTSVSVPSSSTEPSSTPTISSTEHDAHVIPETLAPSPTSPT
SSTTTTEKPETTDAESPIVILQPTPSRKWRVPDTSSADCIGSTEEDCLGTEVWCNRKLYLISDEFFAHADAAACK
QSRTKGPLQPSQQPTINSELPASTTVTTENPNPETTTSPTASMNATEASKTPTEVNPTEVNDSTPVWKVQGGDCG
SGSAAETENCFGTERWCKQRIYQYTSETFDSPMACMRSRKNHPAYVDELLIWKEPHKDHPDCFFESTRDPVALEA
CVGTEEFCENQYYQNFGEPFEDAEECKRSRERRPGVEKKPTGVDGQDPSAGEKPSATEEVSSPGGVVDSATSEST
SADTPEEKEEKDEKSTSDEEQVVPEENDKGVSEEENTPSADEDETADEDETASDEKQSPPADEDKATSEEQNPPA
DETASTQDPSEDNEEENPSENEQVPPEDKDEDTSIDEESAPADEGKASDEEQSPPEDKDTKITEEETPLADEEET
PSADEEASTNEHAEEKSNETPSDKEDKDKDTSVEGDSAPIDEEKKTPGILGHATKFDEKCIGTGLWCSENLWRLT
NESFPSSDACNNDRQSSLGYVSPWKEARDTLDGCLASEGRFTEDCVGTEAWCDGKYMTTGSIRENYSSAEECKEL
RSNRPDGKEVAETTETDFEKIMNGNNDDVIPKDSSFLCWTQGLERISLFCNSMPSECDEDSGCTKLSDLSAMCDE
YKGCGKCHIGKETKNLVCALPKAEELSDRERDGCAQACSLSASTSLGDAVTKVGPFALEKRYIIYP*
Coding >Ophun1|7264
ATGCACTACCCCCTTCTACTCGCCGCTCTGGCGGTGCTACAGCCCGGAACCCACGGCCTGCCCATCACGGAAGAC
GAGCCTCTTTACTGCGAGCCAAGCGCCTCTATCCAAGATGCCGAAGCCAACATACAGTCTGACGGGACCAATATC
GGGCTAACAGGCCCCCAAGCCTCCCTCCTCGTCACCAAGGGCGCCGAGAGCGCCGGTCTCAGCCCGGAAGTTGTA
CAGAAACTAGCCTTGACGGCCGAGAAGGGCATCGGGTCCGCTGATGAATTCGTCAAAGTCGTTGGTGCCGTCAGC
GTCTCGGCCATCGCCTCGGCATCCGGGAAGACGTCTCCGGTTGTAAGAGCTATGGGGGCTATCGAGGGTCTTGTT
ATCGCCAATATGGGAGACTCTCCTGCTTCTCGTAATGTGATGGCCGCAGCTGTTGCAGCCGCGTCGTCTGGTGAG
GATCAGGAGGTTGTGACGAACATCACCGAGAACACAGCCAAGGCAGCAATGAACCATGAAGACGACGCAAATCTC
ATCATGAATGAAGCATCGCAAGGCTGCCGAAGCAAGAGATGCCGCGTCAGCGTCAAGACAGTCATCCAGCTCATC
AGCAGCGGCTTCAGCGTCAAGACGGCGTTGACGGTATGCGCAGCCGTCAACTCGGCTGCCAAGTACGTCATCGAG
CTCGAATCCTACGCCAAAGTACTCGTCCAGCAGGTTTCGCACCTTGAGAAAGGAGTTAAGCCTGGTCAAGCTGCG
CGGAGTGCGGTAGAAGCGAAGACGAGTCTTGGAAACGCGACACAGGCTGCTCAAGATGTGGAGAAGACGATGCTT
GGGACTGCGAGGGAGATTGAGGATTTGCCGTCGCCTGACATGTCCGTCTTGGCTGATGTTGCGGCTAAAGATGAT
CAGAGCACCGAGGTCTCAACCTTTTCCTCTACTCAGACGACGATGCCAGCTTCTGTTGCTGAAACGGCAGAGACG
TCTTCTCCCGCAACTCTGGAGGACTCTACTACCAGCGTGTCAGTCCCTAGTTCTTCCACCGAGCCTTCAAGTACC
CCCACGATATCGTCCACCGAGCACGACGCCCATGTCATTCCCGAGACTCTCGCCCCCTCTCCGACGAGCCCTACC
AGCTCAACCACAACAACCGAAAAGCCCGAAACGACAGACGCCGAATCCCCCATCGTCATCCTACAGCCGACGCCA
TCCAGGAAGTGGCGAGTCCCCGACACAAGCTCAGCCGACTGCATTGGCTCGACAGAAGAAGATTGCTTGGGCACT
GAGGTCTGGTGTAACCGAAAACTCTACTTGATATCTGATGAGTTCTTTGCGCATGCTGACGCCGCTGCGTGTAAA
CAGAGTCGTACCAAGGGGCCTCTGCAGCCCAGCCAGCAACCCACCATCAACAGCGAGTTGCCAGCGTCAACCACT
GTCACAACCGAGAACCCGAACCCGGAAACCACCACGAGCCCGACAGCCTCCATGAACGCAACTGAAGCCTCCAAA
ACGCCAACAGAAGTGAACCCAACAGAAGTGAACGATTCGACACCCGTGTGGAAAGTCCAAGGCGGAGATTGCGGC
AGCGGCAGCGCAGCTGAAACCGAAAACTGCTTCGGCACAGAACGATGGTGCAAGCAACGAATCTACCAGTACACG
TCTGAAACCTTTGACAGCCCCATGGCCTGCATGCGGAGCCGCAAGAACCACCCGGCCTATGTGGACGAGCTCTTG
ATCTGGAAAGAGCCTCACAAGGATCACCCGGACTGCTTCTTCGAGTCGACTCGGGATCCTGTGGCGTTGGAGGCG
TGTGTTGGCACGGAAGAGTTTTGCGAAAACCAGTACTACCAGAACTTTGGGGAGCCCTTTGAGGACGCTGAAGAG
TGTAAGAGGAGTCGCGAGAGGCGTCCAGGCGTTGAGAAAAAGCCGACTGGCGTTGACGGTCAGGATCCTTCGGCT
GGGGAGAAGCCTTCTGCGACGGAGGAGGTCTCTTCTCCGGGCGGCGTCGTGGATTCTGCTACTTCAGAGTCTACG
AGTGCCGACACTCCGGAAGAGAAGGAAGAGAAAGACGAAAAGAGCACTTCTGATGAAGAGCAGGTTGTTCCTGAG
GAGAATGATAAAGGGGTGTCGGAAGAAGAGAACACTCCTTCTGCTGACGAAGACGAGACTGCCGACGAAGACGAG
ACAGCTTCGGATGAGAAGCAGAGTCCTCCCGCGGATGAAGACAAGGCGACTTCAGAAGAGCAGAACCCTCCGGCT
GACGAGACGGCTTCAACCCAAGACCCCTCTGAAGACAACGAGGAAGAGAACCCTTCAGAGAACGAGCAAGTTCCT
CCCGAGGACAAGGATGAAGACACGTCAATCGACGAAGAGAGTGCTCCTGCCGACGAAGGGAAAGCTTCGGATGAG
GAACAGAGCCCTCCCGAGGATAAAGACACCAAGATTACAGAGGAGGAGACTCCTCTAGCTGACGAGGAGGAGACA
CCTTCAGCTGACGAGGAAGCTTCAACCAACGAACATGCTGAAGAGAAGAGCAACGAAACCCCTTCAGACAAGGAG
GACAAAGATAAAGACACCTCGGTTGAGGGCGATAGTGCTCCCATCGACGAAGAGAAAAAGACTCCAGGAATACTG
GGCCACGCAACCAAGTTCGACGAGAAATGCATCGGCACGGGACTCTGGTGCTCCGAGAATCTCTGGCGCCTCACC
AACGAAAGCTTCCCCAGCTCCGACGCATGCAACAACGACCGCCAGTCCTCACTCGGATACGTCAGCCCCTGGAAA
GAGGCAAGGGATACTCTCGACGGTTGTCTCGCCAGCGAGGGACGCTTCACTGAGGACTGCGTGGGGACAGAGGCC
TGGTGTGATGGCAAGTACATGACCACTGGCAGCATCCGGGAGAATTACTCGTCGGCCGAGGAGTGTAAAGAGCTG
CGGAGTAACCGGCCGGATGGGAAGGAGGTTGCTGAAACGACTGAGACGGACTTTGAGAAGATCATGAACGGCAAC
AACGACGACGTCATCCCCAAGGATTCCTCCTTTCTCTGCTGGACACAGGGCTTAGAAAGGATCAGTCTATTCTGC
AACAGCATGCCCAGTGAATGCGACGAAGATTCCGGATGCACCAAGCTGAGCGACCTCTCCGCCATGTGCGACGAG
TACAAAGGCTGCGGGAAATGCCACATCGGCAAAGAAACAAAGAATCTCGTCTGCGCTCTGCCAAAGGCGGAGGAG
CTGAGTGACCGTGAGAGAGACGGTTGCGCGCAGGCTTGTTCGCTCTCTGCCAGCACCTCTCTGGGCGATGCGGTG
ACCAAGGTCGGGCCTTTTGCTTTGGAGAAGCGATACATCATCTATCCGTAG
Transcript >Ophun1|7264
ATGCACTACCCCCTTCTACTCGCCGCTCTGGCGGTGCTACAGCCCGGAACCCACGGCCTGCCCATCACGGAAGAC
GAGCCTCTTTACTGCGAGCCAAGCGCCTCTATCCAAGATGCCGAAGCCAACATACAGTCTGACGGGACCAATATC
GGGCTAACAGGCCCCCAAGCCTCCCTCCTCGTCACCAAGGGCGCCGAGAGCGCCGGTCTCAGCCCGGAAGTTGTA
CAGAAACTAGCCTTGACGGCCGAGAAGGGCATCGGGTCCGCTGATGAATTCGTCAAAGTCGTTGGTGCCGTCAGC
GTCTCGGCCATCGCCTCGGCATCCGGGAAGACGTCTCCGGTTGTAAGAGCTATGGGGGCTATCGAGGGTCTTGTT
ATCGCCAATATGGGAGACTCTCCTGCTTCTCGTAATGTGATGGCCGCAGCTGTTGCAGCCGCGTCGTCTGGTGAG
GATCAGGAGGTTGTGACGAACATCACCGAGAACACAGCCAAGGCAGCAATGAACCATGAAGACGACGCAAATCTC
ATCATGAATGAAGCATCGCAAGGCTGCCGAAGCAAGAGATGCCGCGTCAGCGTCAAGACAGTCATCCAGCTCATC
AGCAGCGGCTTCAGCGTCAAGACGGCGTTGACGGTATGCGCAGCCGTCAACTCGGCTGCCAAGTACGTCATCGAG
CTCGAATCCTACGCCAAAGTACTCGTCCAGCAGGTTTCGCACCTTGAGAAAGGAGTTAAGCCTGGTCAAGCTGCG
CGGAGTGCGGTAGAAGCGAAGACGAGTCTTGGAAACGCGACACAGGCTGCTCAAGATGTGGAGAAGACGATGCTT
GGGACTGCGAGGGAGATTGAGGATTTGCCGTCGCCTGACATGTCCGTCTTGGCTGATGTTGCGGCTAAAGATGAT
CAGAGCACCGAGGTCTCAACCTTTTCCTCTACTCAGACGACGATGCCAGCTTCTGTTGCTGAAACGGCAGAGACG
TCTTCTCCCGCAACTCTGGAGGACTCTACTACCAGCGTGTCAGTCCCTAGTTCTTCCACCGAGCCTTCAAGTACC
CCCACGATATCGTCCACCGAGCACGACGCCCATGTCATTCCCGAGACTCTCGCCCCCTCTCCGACGAGCCCTACC
AGCTCAACCACAACAACCGAAAAGCCCGAAACGACAGACGCCGAATCCCCCATCGTCATCCTACAGCCGACGCCA
TCCAGGAAGTGGCGAGTCCCCGACACAAGCTCAGCCGACTGCATTGGCTCGACAGAAGAAGATTGCTTGGGCACT
GAGGTCTGGTGTAACCGAAAACTCTACTTGATATCTGATGAGTTCTTTGCGCATGCTGACGCCGCTGCGTGTAAA
CAGAGTCGTACCAAGGGGCCTCTGCAGCCCAGCCAGCAACCCACCATCAACAGCGAGTTGCCAGCGTCAACCACT
GTCACAACCGAGAACCCGAACCCGGAAACCACCACGAGCCCGACAGCCTCCATGAACGCAACTGAAGCCTCCAAA
ACGCCAACAGAAGTGAACCCAACAGAAGTGAACGATTCGACACCCGTGTGGAAAGTCCAAGGCGGAGATTGCGGC
AGCGGCAGCGCAGCTGAAACCGAAAACTGCTTCGGCACAGAACGATGGTGCAAGCAACGAATCTACCAGTACACG
TCTGAAACCTTTGACAGCCCCATGGCCTGCATGCGGAGCCGCAAGAACCACCCGGCCTATGTGGACGAGCTCTTG
ATCTGGAAAGAGCCTCACAAGGATCACCCGGACTGCTTCTTCGAGTCGACTCGGGATCCTGTGGCGTTGGAGGCG
TGTGTTGGCACGGAAGAGTTTTGCGAAAACCAGTACTACCAGAACTTTGGGGAGCCCTTTGAGGACGCTGAAGAG
TGTAAGAGGAGTCGCGAGAGGCGTCCAGGCGTTGAGAAAAAGCCGACTGGCGTTGACGGTCAGGATCCTTCGGCT
GGGGAGAAGCCTTCTGCGACGGAGGAGGTCTCTTCTCCGGGCGGCGTCGTGGATTCTGCTACTTCAGAGTCTACG
AGTGCCGACACTCCGGAAGAGAAGGAAGAGAAAGACGAAAAGAGCACTTCTGATGAAGAGCAGGTTGTTCCTGAG
GAGAATGATAAAGGGGTGTCGGAAGAAGAGAACACTCCTTCTGCTGACGAAGACGAGACTGCCGACGAAGACGAG
ACAGCTTCGGATGAGAAGCAGAGTCCTCCCGCGGATGAAGACAAGGCGACTTCAGAAGAGCAGAACCCTCCGGCT
GACGAGACGGCTTCAACCCAAGACCCCTCTGAAGACAACGAGGAAGAGAACCCTTCAGAGAACGAGCAAGTTCCT
CCCGAGGACAAGGATGAAGACACGTCAATCGACGAAGAGAGTGCTCCTGCCGACGAAGGGAAAGCTTCGGATGAG
GAACAGAGCCCTCCCGAGGATAAAGACACCAAGATTACAGAGGAGGAGACTCCTCTAGCTGACGAGGAGGAGACA
CCTTCAGCTGACGAGGAAGCTTCAACCAACGAACATGCTGAAGAGAAGAGCAACGAAACCCCTTCAGACAAGGAG
GACAAAGATAAAGACACCTCGGTTGAGGGCGATAGTGCTCCCATCGACGAAGAGAAAAAGACTCCAGGAATACTG
GGCCACGCAACCAAGTTCGACGAGAAATGCATCGGCACGGGACTCTGGTGCTCCGAGAATCTCTGGCGCCTCACC
AACGAAAGCTTCCCCAGCTCCGACGCATGCAACAACGACCGCCAGTCCTCACTCGGATACGTCAGCCCCTGGAAA
GAGGCAAGGGATACTCTCGACGGTTGTCTCGCCAGCGAGGGACGCTTCACTGAGGACTGCGTGGGGACAGAGGCC
TGGTGTGATGGCAAGTACATGACCACTGGCAGCATCCGGGAGAATTACTCGTCGGCCGAGGAGTGTAAAGAGCTG
CGGAGTAACCGGCCGGATGGGAAGGAGGTTGCTGAAACGACTGAGACGGACTTTGAGAAGATCATGAACGGCAAC
AACGACGACGTCATCCCCAAGGATTCCTCCTTTCTCTGCTGGACACAGGGCTTAGAAAGGATCAGTCTATTCTGC
AACAGCATGCCCAGTGAATGCGACGAAGATTCCGGATGCACCAAGCTGAGCGACCTCTCCGCCATGTGCGACGAG
TACAAAGGCTGCGGGAAATGCCACATCGGCAAAGAAACAAAGAATCTCGTCTGCGCTCTGCCAAAGGCGGAGGAG
CTGAGTGACCGTGAGAGAGACGGTTGCGCGCAGGCTTGTTCGCTCTCTGCCAGCACCTCTCTGGGCGATGCGGTG
ACCAAGGTCGGGCCTTTTGCTTTGGAGAAGCGATACATCATCTATCCGTAG
Gene >Ophun1|7264
ATGCACTACCCCCTTCTACTCGCCGCTCTGGCGGTGCTACAGCCCGGAACCCACGGCCTGCCCATCACGGAAGAC
GAGCCTCTTTACTGCGAGCCAAGCGCCTCTATCCAAGATGCCGAAGCCAACATACAGTCTGACGGGACCAATATC
GGGCTAACAGGCCCCCAAGCCTCCCTCCTCGTCACCAAGGGCGCCGAGAGCGCCGGTCTCAGCCCGGAAGTTGTA
CAGAAACTAGCCTTGACGGCCGAGAAGGGCATCGGGTCCGCTGATGAATTCGTCAAAGTCGTTGGTGCCGTCAGC
GTCTCGGCCATCGCCTCGGCATCCGGGAAGACGTCTCCGGTTGTAAGAGCTATGGGGGCTATCGAGGGTCTTGTT
ATCGCCAATATGGGAGACTCTCCTGCTTCTCGTAATGTGATGGCCGCAGCTGTTGCAGCCGCGTCGTCTGGTGAG
GATCAGGAGGTTGTGACGAACATCACCGAGAACACAGCCAAGGCAGCAATGAACCATGAAGACGACGCAAATCTC
ATCATGAATGAAGCATCGCAAGGCTGCCGAAGCAAGAGATGCCGCGTCAGCGTCAAGACAGTCATCCAGCTCATC
AGCAGCGGCTTCAGCGTCAAGACGGCGTTGACGGTATGCGCAGCCGTCAACTCGGCTGCCAAGTACGTCATCGAG
CTCGAATCCTACGCCAAAGTACTCGTCCAGCAGGTTTCGCACCTTGAGAAAGGAGTTAAGCCTGGTCAAGCTGCG
CGGAGTGCGGTAGAAGCGAAGACGAGTCTTGGAAACGCGACACAGGCTGCTCAAGATGTGGAGAAGACGATGCTT
GGGACTGCGAGGGAGATTGAGGATTTGCCGTCGCCTGACATGTCCGTCTTGGCTGATGTTGCGGCTAAAGATGAT
CAGAGCAGTGAGGAGGGGATGGCTTCTGAAGTGGCGGAGGCATCACCTACGATTATCGACGCTGGTGAAGCAACT
TCAAGCTCTGTCTCTCAAGTGATGGAACCCTCTTCTGTCGTTTCGGTAACTACATCTTCGAGTGTCTCACAGACG
GATTCTGTCTTGACTTCGACAACTTCAGCTTCACTTACAGACTCGACAACATCGAATGAGAGCCGTGGGACAACT
ACAGTGTCCCAGGAGAAAAACGCTGCGCCAACAAACACCATTTTGTCTATAGAAGCGTCTACTTCTACTCAGATT
GAGAGTTCTGCGACTATTTCGATGGCGAGCGATTCACCTATGGCTCCTATGACAGAGGCCTCCTCTTCTATGGTC
ATGGATGATTCTGCAACAACTGACAAGCCGCTGGCTTTGGTTACGGAGACCTCATCTTCTCCGGCAGCCGAGGTC
TCAACCTTTTCCTCTACTCAGACGACGATGCCAGCTTCTGTTGCTGAAACGGCAGAGACGTCTTCTCCCGCAACT
CTGGAGGACTCTACTACCAGCGTGTCAGTCCCTAGTTCTTCCACCGAGCCTTCAAGTACCCCCACGATATCGTCC
ACCGAGCACGACGCCCATGTCATTCCCGAGACTCTCGCCCCCTCTCCGACGAGCCCTACCAGCTCAACCACAACA
ACCGAAAAGCCCGAAACGACAGACGCCGAATCCCCCATCGTCATCCTACAGCCGACGCCATCCAGGAAGTGGCGA
GTCCCCGACACAAGCTCAGCCGACTGCATTGGCTCGACAGAAGAAGATTGCTTGGGCACTGAGGTCTGGTGTAAC
CGAAAACTCTACTTGATATCTGATGAGTTCTTTGCGCATGCTGACGCCGCTGCGTGTAAACAGAGTCGTACCAAG
GGGCCTCTGGTGAGCATCCAAGTCTCTATCCCTGCTTCAATAACAACCGCTGATGGTTAAAGCAGCCCAGCCAGC
AACCCACCATCAACAGCGAGTTGCCAGCGTCAACCACTGTCACAACCGAGAACCCGAACCCGGAAACCACCACGA
GCCCGACAGCCTCCATGAACGCAACTGAAGCCTCCAAAACGCCAACAGAAGTGAACCCAACAGAAGTGAACGATT
CGACACCCGTGTGGAAAGTCCAAGGCGGAGATTGCGGCAGCGGCAGCGCAGCTGAAACCGAAAACTGCTTCGGCA
CAGAACGATGGTGCAAGCAACGAATCTACCAGTACACGTCTGAAACCTTTGACAGCCCCATGGCCTGCATGCGGA
GCCGCAAGAACCACCCGGCCTATGTGGACGAGCTCTTGATCTGGAAAGAGCCTCACAAGGATCACCCGGACTGCT
TCTTCGAGTCGACTCGGGATCCTGTGGCGTTGGAGGCGTGTGTTGGCACGGAAGAGTTTTGCGAAAACCAGTACT
ACCAGAACTTTGGGGAGCCCTTTGAGGACGCTGAAGAGTGTAAGAGGAGTCGCGAGAGGCGTCCAGGCGTTGAGA
AAAAGCCGACTGGCGTTGACGGTCAGGATCCTTCGGCTGGGGAGAAGCCTTCTGCGACGGAGGAGGTCTCTTCTC
CGGGCGGCGTCGTGGATTCTGCTACTTCAGAGTCTACGAGTGCCGACACTCCGGAAGAGAAGGAAGAGAAAGACG
AAAAGAGCACTTCTGATGAAGAGCAGGTTGTTCCTGAGGAGAATGATAAAGGGGTGTCGGAAGAAGAGAACACTC
CTTCTGCTGACGAAGACGAGACTGCCGACGAAGACGAGACAGCTTCGGATGAGAAGCAGAGTCCTCCCGCGGATG
AAGACAAGGCGACTTCAGAAGAGCAGAACCCTCCGGCTGACGAGACGGCTTCAACCCAAGACCCCTCTGAAGACA
ACGAGGAAGAGAACCCTTCAGAGAACGAGCAAGTTCCTCCCGAGGACAAGGATGAAGACACGTCAATCGACGAAG
AGAGTGCTCCTGCCGACGAAGGGAAAGCTTCGGATGAGGAACAGAGCCCTCCCGAGGATAAAGACACCAAGATTA
CAGAGGAGGAGACTCCTCTAGCTGACGAGGAGGAGACACCTTCAGCTGACGAGGAAGCTTCAACCAACGAACATG
CTGAAGAGAAGAGCAACGAAACCCCTTCAGACAAGGAGGACAAAGATAAAGACACCTCGGTTGAGGGCGATAGTG
CTCCCATCGACGAAGAGAAAAAGACTCCAGGTGATAAGCAGATCCCTCCAGCAGAAGAAGACAAGTCTTCAGAAG
AGCAAGACCCTCCAGCCGACGACAAAAACAATCAGCCCAAGCCAGTCGAAAGGAGATGGAAACACCCCAGACGAG
ACAGCCCATTCTGCTCAGGAATACTGGGCCACGCAACCAAGTTCGACGAGAAATGCATCGGCACGGGACTCTGGT
GCTCCGAGAATCTCTGGCGCCTCACCAACGAAAGCTTCCCCAGCTCCGACGCATGCAACAACGACCGCCAGTCCT
CACTCGGATACGTCAGCCCCTGGAAAGAGGCAAGGGATACTCTCGACGGTTGTCTCGCCAGCGAGGGACGCTTCA
CTGAGGACTGCGTGGGGACAGAGGCCTGGTGTGATGGCAAGTACATGACCACTGGCAGCATCCGGGAGAATTACT
CGTCGGCCGAGGAGTGTAAAGAGCTGCGGAGTAACCGGCCGGATGGGAAGGAGGTTGCTGAAACGACTGAGACGG
TGCGTCGTGGCTTATACGAAGCAGCTTGTCATCTCATACTGACGGAGAGGGAATGAATAGGACTTTGAGAAGATC
ATGAACGGCAACAACGACGACGTCATCCCCAAGGATTCCTCCTTTCTCTGCTGGACACAGGTGAGCCCCTTTCTC
GCCTTACAGACGTTTCACCAGCAGCTGCTAAAGATGGCCAACAGGGCTTAGAAAGGATCAGTCTATTCTGCAACA
GCATGCCCAGTGAATGCGACGAAGATTCCGGATGCACCAAGCTGAGCGACCTCTCCGCCATGTGCGACGAGTACA
AAGGCTGCGGGAAATGCCACATCGGCAAAGAAACAAAGGTCCGTACAACCTCTCAACATACAGAGAACGGGTCAA
GACTAACAGCCGCTAGAATCTCGTCTGCGCTCTGCCAAAGGCGGAGGAGCTGAGTGACCGTGAGAGAGACGGTTG
CGCGCAGGCTTGTTCGCTCTCTGCCAGCACCTCTCTGGGCGATGCGGTGACCAAGGTCGGGCCTTTTGCTTTGGA
GAAGGTTTGTAATGGTTTCTACTGTTGATGATGGGGGTATAGAGGCCAGAGGGTGATGAAATGGAAGAGAAGGGG
GCGTGGTGGTGACTTGGTTGAAGAGATTCATCAACTCGCGGGGAATGCTGGGTGGACTTTACCTGATGATTATAT
TTTCTTTTGTTTACATAGATAGATGGATGGATAATGTCTTTCAGCAAGATGTAGTCACAGATCTCTTGCCGATGG
TTGACGATGCGCGATTACAGCGATACATCATCTATCCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail