Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7261
Gene name
LocationContig_89:22642..23123
Strand+
Gene length (bp)481
Transcript length (bp)423
Coding sequence length (bp)423
Protein length (aa) 141

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 18 0.99945

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2396
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2684
Ophiocordyceps australis map64 (Brazil) OphauB2|3997
Ophiocordyceps camponoti-floridani Ophcf2|06982
Ophiocordyceps camponoti-rufipedis Ophun1|7261 (this protein)
Ophiocordyceps kimflemingae Ophio5|7250
Ophiocordyceps subramaniannii Hirsu2|3384

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7261
MLISSLATALVLAASCLAHPKVLRKQADMRLFSGDNCTKGNLGIWTVVEGDMFPWECKMFPAAVGSVSVEDIYEG
CTITLHVDDECKPTLTSTEKKLHEGDEAKWPQCVISRTGLSYKAFSISCEFQNDPSLWQFEHHHH*
Coding >Ophun1|7261
ATGTTGATCTCGTCTCTCGCAACGGCCCTCGTCCTGGCCGCCAGCTGCCTGGCCCATCCCAAGGTGCTCAGGAAA
CAGGCCGACATGCGCCTCTTCAGCGGCGACAATTGCACAAAGGGCAATCTCGGCATCTGGACCGTCGTCGAGGGC
GACATGTTCCCTTGGGAGTGCAAGATGTTCCCGGCTGCCGTCGGCTCCGTCAGCGTCGAGGATATATACGAGGGC
TGCACGATCACCCTCCACGTCGACGACGAATGCAAGCCCACCTTGACAAGCACGGAAAAGAAGTTGCACGAGGGA
GACGAGGCGAAGTGGCCGCAATGCGTCATCTCTCGTACGGGCTTGTCTTACAAGGCCTTTTCCATAAGCTGCGAA
TTCCAGAATGATCCGAGTCTCTGGCAATTTGAGCACCACCACCATTGA
Transcript >Ophun1|7261
ATGTTGATCTCGTCTCTCGCAACGGCCCTCGTCCTGGCCGCCAGCTGCCTGGCCCATCCCAAGGTGCTCAGGAAA
CAGGCCGACATGCGCCTCTTCAGCGGCGACAATTGCACAAAGGGCAATCTCGGCATCTGGACCGTCGTCGAGGGC
GACATGTTCCCTTGGGAGTGCAAGATGTTCCCGGCTGCCGTCGGCTCCGTCAGCGTCGAGGATATATACGAGGGC
TGCACGATCACCCTCCACGTCGACGACGAATGCAAGCCCACCTTGACAAGCACGGAAAAGAAGTTGCACGAGGGA
GACGAGGCGAAGTGGCCGCAATGCGTCATCTCTCGTACGGGCTTGTCTTACAAGGCCTTTTCCATAAGCTGCGAA
TTCCAGAATGATCCGAGTCTCTGGCAATTTGAGCACCACCACCATTGA
Gene >Ophun1|7261
ATGTTGATCTCGTCTCTCGCAACGGCCCTCGTCCTGGCCGCCAGCTGCCTGGCCCATCCCAAGGTGCTCAGGAAA
CAGGCCGACATGCGCCTCTTCAGCGGCGACAATTGCACAAAGGGCAATCTCGGCATCTGGACCGTCGTCGAGGGC
GACATGTTCCCTTGGGAGTGCAAGATGTTCCCGGCTGCCGTCGGCTCCGTCAGCGTCGAGGATATATACGAGGGC
TGCACGAGTGAGTCTGCTGCCGAGTGTTCCATGCTGTCTGATAACTGGTTAACGCCTTCTCCCAGTCACCCTCCA
CGTCGACGACGAATGCAAGCCCACCTTGACAAGCACGGAAAAGAAGTTGCACGAGGGAGACGAGGCGAAGTGGCC
GCAATGCGTCATCTCTCGTACGGGCTTGTCTTACAAGGCCTTTTCCATAAGCTGCGAATTCCAGAATGATCCGAG
TCTCTGGCAATTTGAGCACCACCACCATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail