Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7258
Gene name
LocationContig_89:14955..16884
Strand+
Gene length (bp)1929
Transcript length (bp)1806
Coding sequence length (bp)1806
Protein length (aa) 602

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 1.5E-60 112 562
PF07690 MFS_1 Major Facilitator Superfamily 4.3E-15 161 473

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38156|MAL31_YEAST Maltose permease MAL31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAL31 PE=1 SV=1 73 571 5.0E-87
sp|P15685|MAL61_YEASX Maltose permease MAL61 OS=Saccharomyces cerevisiae GN=MAL61 PE=3 SV=1 72 571 4.0E-86
sp|P0CD99|MPH2_YEAST Alpha-glucosides permease MPH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPH2 PE=2 SV=1 73 587 9.0E-85
sp|P0CE00|MPH3_YEAST Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPH3 PE=1 SV=1 73 571 1.0E-84
sp|B5VF36|MPH3_YEAS6 Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=MPH3 PE=3 SV=1 73 571 2.0E-84
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38156|MAL31_YEAST Maltose permease MAL31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAL31 PE=1 SV=1 73 571 5.0E-87
sp|P15685|MAL61_YEASX Maltose permease MAL61 OS=Saccharomyces cerevisiae GN=MAL61 PE=3 SV=1 72 571 4.0E-86
sp|P0CD99|MPH2_YEAST Alpha-glucosides permease MPH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPH2 PE=2 SV=1 73 587 9.0E-85
sp|P0CE00|MPH3_YEAST Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPH3 PE=1 SV=1 73 571 1.0E-84
sp|B5VF36|MPH3_YEAS6 Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=MPH3 PE=3 SV=1 73 571 2.0E-84
sp|A6ZX88|MPH3_YEAS7 Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain YJM789) GN=MPH3 PE=3 SV=1 73 571 2.0E-84
sp|C8Z6M6|MPH3_YEAS8 Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=MPH3 PE=3 SV=1 73 571 3.0E-84
sp|P53048|MAL11_YEAST General alpha-glucoside permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAL11 PE=1 SV=1 67 572 2.0E-81
sp|Q92253|RCO3_NEUCR Probable glucose transporter rco-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-3 PE=3 SV=2 114 563 4.0E-23
sp|Q9ZNS0|PLT3_ARATH Probable polyol transporter 3 OS=Arabidopsis thaliana GN=PLT3 PE=3 SV=1 166 562 5.0E-20
sp|Q9XIH6|PLT2_ARATH Putative polyol transporter 2 OS=Arabidopsis thaliana GN=PLT2 PE=3 SV=1 165 576 5.0E-19
sp|Q6MYX6|QUTD_ASPFU Probable quinate permease OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=qutD PE=3 SV=1 203 590 6.0E-19
sp|Q9XIH7|PLT1_ARATH Putative polyol transporter 1 OS=Arabidopsis thaliana GN=PLT1 PE=3 SV=1 201 579 5.0E-18
sp|Q8GXR2|PLT6_ARATH Probable polyol transporter 6 OS=Arabidopsis thaliana GN=PLT6 PE=2 SV=2 166 563 8.0E-18
sp|A1CPX0|QUTD_ASPCL Probable quinate permease OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=qutD PE=3 SV=1 203 589 2.0E-17
sp|O34718|IOLT_BACSU Major myo-inositol transporter IolT OS=Bacillus subtilis (strain 168) GN=iolT PE=2 SV=1 167 559 2.0E-17
sp|C0SPB2|YWTG_BACSU Putative metabolite transport protein YwtG OS=Bacillus subtilis (strain 168) GN=ywtG PE=3 SV=1 162 560 8.0E-17
sp|P54723|YFIG_BACSU Putative metabolite transport protein YfiG OS=Bacillus subtilis (strain 168) GN=yfiG PE=3 SV=1 149 552 2.0E-16
sp|P38695|HXT5_YEAST Probable glucose transporter HXT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT5 PE=1 SV=1 212 563 3.0E-16
sp|P39932|STL1_YEAST Sugar transporter STL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STL1 PE=1 SV=2 108 562 1.0E-15
sp|Q12300|RGT2_YEAST High-affinity glucose transporter RGT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGT2 PE=1 SV=1 228 592 1.0E-15
sp|P94493|YNCC_BACSU Putative metabolite transport protein YncC OS=Bacillus subtilis (strain 168) GN=yncC PE=3 SV=2 168 559 3.0E-15
sp|Q90592|GTR2_CHICK Solute carrier family 2, facilitated glucose transporter member 2 OS=Gallus gallus GN=SLC2A2 PE=2 SV=1 208 569 3.0E-15
sp|P10870|SNF3_YEAST High-affinity glucose transporter SNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF3 PE=1 SV=3 208 562 5.0E-15
sp|Q8VZ80|PLT5_ARATH Polyol transporter 5 OS=Arabidopsis thaliana GN=PLT5 PE=1 SV=2 204 563 5.0E-15
sp|Q8L6Z8|XYLL1_ARATH D-xylose-proton symporter-like 1 OS=Arabidopsis thaliana GN=At3g03090 PE=2 SV=1 157 559 5.0E-15
sp|P46333|CSBC_BACSU Probable metabolite transport protein CsbC OS=Bacillus subtilis (strain 168) GN=csbC PE=1 SV=3 166 559 6.0E-15
sp|Q94CI7|EDL17_ARATH Sugar transporter ERD6-like 17 OS=Arabidopsis thaliana GN=SFP1 PE=2 SV=2 167 560 3.0E-14
sp|A2QQV6|QUTD_ASPNC Probable quinate permease OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=qutD PE=3 SV=1 203 586 3.0E-14
sp|P07921|LACP_KLULA Lactose permease OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LAC12 PE=3 SV=1 193 569 6.0E-14
sp|Q2U2Y9|QUTD_ASPOR Probable quinate permease OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=qutD PE=3 SV=1 208 590 1.0E-13
sp|B8NIM7|QUTD_ASPFN Probable quinate permease OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=qutD PE=3 SV=1 208 590 1.0E-13
sp|P53387|KHT2_KLULC Hexose transporter 2 OS=Kluyveromyces lactis GN=KHT2 PE=3 SV=1 212 595 5.0E-13
sp|P15325|QUTD_EMENI Quinate permease OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=qutD PE=1 SV=2 110 588 5.0E-13
sp|Q4F7G0|ERDL2_ARATH Sugar transporter ERD6-like 2 OS=Arabidopsis thaliana GN=SUGTL3 PE=2 SV=1 134 559 8.0E-13
sp|Q0D135|QUTD_ASPTN Probable quinate permease OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=qutD PE=3 SV=1 203 586 8.0E-13
sp|B0XQS8|QUTD_ASPFC Probable quinate permease OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=qutD PE=3 SV=1 203 590 1.0E-12
sp|P13181|GAL2_YEAST Galactose transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAL2 PE=1 SV=3 212 595 1.0E-12
sp|Q0WWW9|XYLL3_ARATH D-xylose-proton symporter-like 3, chloroplastic OS=Arabidopsis thaliana GN=At5g59250 PE=2 SV=2 185 559 1.0E-12
sp|O04036|ERD6_ARATH Sugar transporter ERD6 OS=Arabidopsis thaliana GN=ERD6 PE=1 SV=3 166 563 2.0E-12
sp|P18631|RAG1_KLULA Low-affinity glucose transporter OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAG1 PE=1 SV=1 212 595 3.0E-12
sp|Q6AWX0|XYLL2_ARATH D-xylose-proton symporter-like 2 OS=Arabidopsis thaliana GN=At5g17010 PE=1 SV=1 159 559 3.0E-12
sp|P23585|HXT2_YEAST High-affinity glucose transporter HXT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT2 PE=1 SV=1 98 496 6.0E-12
sp|P11636|QAY_NEUCR Quinate permease OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=qa-y PE=3 SV=2 114 592 7.0E-12
sp|P14246|GTR2_MOUSE Solute carrier family 2, facilitated glucose transporter member 2 OS=Mus musculus GN=Slc2a2 PE=1 SV=3 185 587 7.0E-12
sp|O59932|GHT4_SCHPO High-affinity hexose transporter ght4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght4 PE=3 SV=2 121 563 8.0E-12
sp|Q4U3U4|QAY_NEUTR Quinate permease OS=Neurospora terricola GN=qa-y PE=3 SV=1 114 593 8.0E-12
sp|A1D2R3|QUTD_NEOFI Probable quinate permease OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=qutD PE=3 SV=1 203 590 2.0E-11
sp|Q0WUU6|PLT4_ARATH Probable polyol transporter 4 OS=Arabidopsis thaliana GN=PLT4 PE=2 SV=1 204 563 2.0E-11
sp|Q8VZR6|INT1_ARATH Inositol transporter 1 OS=Arabidopsis thaliana GN=INT1 PE=1 SV=1 208 566 3.0E-11
sp|Q94CI6|EDL18_ARATH Sugar transporter ERD6-like 18 OS=Arabidopsis thaliana GN=SFP2 PE=2 SV=1 160 559 3.0E-11
sp|P0AE24|ARAE_ECOLI Arabinose-proton symporter OS=Escherichia coli (strain K12) GN=araE PE=1 SV=1 167 557 3.0E-11
sp|P0AE25|ARAE_ECO57 Arabinose-proton symporter OS=Escherichia coli O157:H7 GN=araE PE=3 SV=1 167 557 3.0E-11
sp|A9ZSY3|TRET1_BOMMO Facilitated trehalose transporter Tret1 OS=Bombyx mori GN=Tret1 PE=1 SV=1 166 580 4.0E-11
sp|P45598|ARAE_KLEOX Arabinose-proton symporter OS=Klebsiella oxytoca GN=araE PE=3 SV=1 167 557 4.0E-11
sp|P43562|YFE0_YEAST Probable metabolite transport protein YFL040W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YFL040W PE=1 SV=1 112 586 5.0E-11
sp|Q9C757|INT2_ARATH Probable inositol transporter 2 OS=Arabidopsis thaliana GN=INT2 PE=1 SV=1 204 439 6.0E-11
sp|Q94AZ2|STP13_ARATH Sugar transport protein 13 OS=Arabidopsis thaliana GN=STP13 PE=1 SV=2 176 553 7.0E-11
sp|P43581|HXT10_YEAST Hexose transporter HXT10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT10 PE=1 SV=1 212 496 8.0E-11
sp|P54854|HXT15_YEAST Hexose transporter HXT15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT15 PE=1 SV=1 212 600 1.0E-10
sp|P28568|GTR3_CHICK Solute carrier family 2, facilitated glucose transporter member 3 OS=Gallus gallus GN=SLC2A3 PE=2 SV=1 208 593 2.0E-10
sp|P40886|HXT8_YEAST Hexose transporter HXT8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT8 PE=1 SV=1 212 491 2.0E-10
sp|Q4U3U6|QAY_NEUAF Quinate permease OS=Neurospora africana GN=qa-y PE=3 SV=1 114 593 2.0E-10
sp|P39003|HXT6_YEAST High-affinity hexose transporter HXT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT6 PE=1 SV=2 212 563 3.0E-10
sp|P39004|HXT7_YEAST High-affinity hexose transporter HXT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT7 PE=1 SV=1 212 563 3.0E-10
sp|Q9LTP6|EDL13_ARATH Putative sugar transporter ERD6-like 13 OS=Arabidopsis thaliana GN=At3g20460 PE=3 SV=2 166 559 3.0E-10
sp|Q0WVE9|PLST1_ARATH Probable plastidic glucose transporter 1 OS=Arabidopsis thaliana GN=At1g05030 PE=2 SV=2 162 560 3.0E-10
sp|Q93Z80|EDL10_ARATH Sugar transporter ERD6-like 10 OS=Arabidopsis thaliana GN=At3g05160 PE=2 SV=1 167 429 4.0E-10
sp|O74849|GHT6_SCHPO High-affinity fructose transporter ght6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght6 PE=1 SV=1 167 593 4.0E-10
sp|Q9WV38|GTR5_MOUSE Solute carrier family 2, facilitated glucose transporter member 5 OS=Mus musculus GN=Slc2a5 PE=1 SV=2 167 565 5.0E-10
sp|Q07647|GTR3_RAT Solute carrier family 2, facilitated glucose transporter member 3 OS=Rattus norvegicus GN=Slc2a3 PE=1 SV=1 138 570 6.0E-10
sp|Q32NG5|GTR12_XENLA Solute carrier family 2, facilitated glucose transporter member 12 OS=Xenopus laevis GN=slc2a12 PE=2 SV=1 156 453 7.0E-10
sp|P47185|HXT16_YEAST Hexose transporter HXT16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT16 PE=3 SV=1 212 600 7.0E-10
sp|P12336|GTR2_RAT Solute carrier family 2, facilitated glucose transporter member 2 OS=Rattus norvegicus GN=Slc2a2 PE=2 SV=1 185 587 2.0E-09
sp|Q8GXK5|EDL14_ARATH Sugar transporter ERD6-like 14 OS=Arabidopsis thaliana GN=At4g04750 PE=2 SV=2 166 562 2.0E-09
sp|Q66J52|S226B_XENLA Solute carrier family 22 member 6-B OS=Xenopus laevis GN=slc22a6-b PE=2 SV=1 154 453 3.0E-09
sp|Q94AF9|EDL11_ARATH Sugar transporter ERD6-like 11 OS=Arabidopsis thaliana GN=At3g05165 PE=2 SV=2 167 559 3.0E-09
sp|P47842|GTR3_CANLF Solute carrier family 2, facilitated glucose transporter member 3 OS=Canis lupus familiaris GN=SLC2A3 PE=2 SV=1 203 563 3.0E-09
sp|O04249|STP7_ARATH Sugar transport protein 7 OS=Arabidopsis thaliana GN=STP7 PE=2 SV=1 166 561 3.0E-09
sp|Q07423|HEX6_RICCO Hexose carrier protein HEX6 OS=Ricinus communis GN=HEX6 PE=2 SV=1 204 561 4.0E-09
sp|P11168|GTR2_HUMAN Solute carrier family 2, facilitated glucose transporter member 2 OS=Homo sapiens GN=SLC2A2 PE=1 SV=1 141 566 4.0E-09
sp|P32465|HXT1_YEAST Low-affinity glucose transporter HXT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT1 PE=1 SV=1 212 595 4.0E-09
sp|Q9SCW7|ERDL1_ARATH Sugar transporter ERD6-like 1 OS=Arabidopsis thaliana GN=SUGTL4 PE=2 SV=2 134 552 5.0E-09
sp|P0AGF4|XYLE_ECOLI D-xylose-proton symporter OS=Escherichia coli (strain K12) GN=xylE PE=1 SV=1 205 563 5.0E-09
sp|P0AGF5|XYLE_ECO57 D-xylose-proton symporter OS=Escherichia coli O157:H7 GN=xylE PE=3 SV=1 205 563 5.0E-09
sp|Q9XSC2|GTR3_RABIT Solute carrier family 2, facilitated glucose transporter member 3 (Fragment) OS=Oryctolagus cuniculus GN=SLC2A3 PE=2 SV=1 203 566 5.0E-09
sp|Q6PXP3|GTR7_HUMAN Solute carrier family 2, facilitated glucose transporter member 7 OS=Homo sapiens GN=SLC2A7 PE=2 SV=2 211 570 6.0E-09
sp|O52733|XYLT_LACBR D-xylose-proton symporter OS=Lactobacillus brevis GN=xylT PE=3 SV=1 153 491 6.0E-09
sp|P39924|HXT13_YEAST Hexose transporter HXT13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT13 PE=1 SV=1 212 601 6.0E-09
sp|Q8GW61|STP14_ARATH Sugar transport protein 14 OS=Arabidopsis thaliana GN=STP14 PE=2 SV=2 175 561 8.0E-09
sp|P79365|GTR1_SHEEP Solute carrier family 2, facilitated glucose transporter member 1 (Fragment) OS=Ovis aries GN=SLC2A1 PE=2 SV=1 203 558 8.0E-09
sp|P47843|GTR3_SHEEP Solute carrier family 2, facilitated glucose transporter member 3 OS=Ovis aries GN=SLC2A3 PE=2 SV=1 116 563 8.0E-09
sp|P23586|STP1_ARATH Sugar transport protein 1 OS=Arabidopsis thaliana GN=STP1 PE=1 SV=2 115 431 1.0E-08
sp|P58352|GTR3_BOVIN Solute carrier family 2, facilitated glucose transporter member 3 OS=Bos taurus GN=SLC2A3 PE=2 SV=1 203 563 1.0E-08
sp|B0WC46|TRET1_CULQU Facilitated trehalose transporter Tret1 OS=Culex quinquefasciatus GN=Tret1 PE=3 SV=1 166 559 1.0E-08
sp|A4ZYQ5|GTR7_RAT Solute carrier family 2, facilitated glucose transporter member 7 OS=Rattus norvegicus GN=Slc2a7 PE=2 SV=1 211 570 1.0E-08
sp|P27674|GTR1_BOVIN Solute carrier family 2, facilitated glucose transporter member 1 OS=Bos taurus GN=SLC2A1 PE=1 SV=1 203 558 2.0E-08
sp|P46896|GTR1_CHICK Solute carrier family 2, facilitated glucose transporter member 1 OS=Gallus gallus GN=SLC2A1 PE=2 SV=1 141 582 2.0E-08
sp|Q01440|GTR1_LEIDO Membrane transporter D1 OS=Leishmania donovani PE=3 SV=1 150 566 2.0E-08
sp|P20303|GTR1_PIG Solute carrier family 2, facilitated glucose transporter member 1 OS=Sus scrofa GN=SLC2A1 PE=2 SV=2 149 558 2.0E-08
sp|P53631|HXT17_YEAST Hexose transporter HXT17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT17 PE=3 SV=1 212 601 2.0E-08
sp|Q9SX48|STP9_ARATH Sugar transport protein 9 OS=Arabidopsis thaliana GN=STP9 PE=1 SV=1 184 553 2.0E-08
sp|Q9SD00|MSSP3_ARATH Monosaccharide-sensing protein 3 OS=Arabidopsis thaliana GN=MSSP3 PE=2 SV=1 173 330 2.0E-08
sp|P13355|GTR1_RABIT Solute carrier family 2, facilitated glucose transporter member 1 OS=Oryctolagus cuniculus GN=SLC2A1 PE=2 SV=1 166 558 3.0E-08
sp|Q96QE2|MYCT_HUMAN Proton myo-inositol cotransporter OS=Homo sapiens GN=SLC2A13 PE=1 SV=3 147 451 3.0E-08
sp|P11166|GTR1_HUMAN Solute carrier family 2, facilitated glucose transporter member 1 OS=Homo sapiens GN=SLC2A1 PE=1 SV=2 203 558 3.0E-08
sp|P11167|GTR1_RAT Solute carrier family 2, facilitated glucose transporter member 1 OS=Rattus norvegicus GN=Slc2a1 PE=1 SV=1 203 558 4.0E-08
sp|Q2V4B9|PLST3_ARATH Probable plastidic glucose transporter 3 OS=Arabidopsis thaliana GN=At1g79820 PE=2 SV=2 162 561 4.0E-08
sp|P17809|GTR1_MOUSE Solute carrier family 2, facilitated glucose transporter member 1 OS=Mus musculus GN=Slc2a1 PE=1 SV=4 142 558 4.0E-08
sp|P32037|GTR3_MOUSE Solute carrier family 2, facilitated glucose transporter member 3 OS=Mus musculus GN=Slc2a3 PE=1 SV=1 138 570 5.0E-08
sp|Q5J316|GTR12_BOVIN Solute carrier family 2, facilitated glucose transporter member 12 OS=Bos taurus GN=SLC2A12 PE=1 SV=1 158 453 6.0E-08
sp|Q93YP9|ERDL4_ARATH Sugar transporter ERD6-like 4 OS=Arabidopsis thaliana GN=At1g19450 PE=2 SV=1 69 442 7.0E-08
sp|Q8LBI9|EDL16_ARATH Sugar transporter ERD6-like 16 OS=Arabidopsis thaliana GN=At5g18840 PE=2 SV=2 166 559 7.0E-08
sp|Q8MKK4|TRE12_DROME Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila melanogaster GN=Tret1-2 PE=2 SV=1 91 595 8.0E-08
sp|O74969|GHT2_SCHPO High-affinity glucose transporter ght2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght2 PE=1 SV=1 166 562 9.0E-08
sp|P58353|GTR5_BOVIN Solute carrier family 2, facilitated glucose transporter member 5 OS=Bos taurus GN=SLC2A5 PE=1 SV=2 167 562 9.0E-08
sp|P43427|GTR5_RAT Solute carrier family 2, facilitated glucose transporter member 5 OS=Rattus norvegicus GN=Slc2a5 PE=1 SV=1 167 565 1.0E-07
sp|P93051|ERDL7_ARATH Sugar transporter ERD6-like 7 OS=Arabidopsis thaliana GN=At2g48020 PE=2 SV=2 166 444 1.0E-07
sp|Q8TD20|GTR12_HUMAN Solute carrier family 2, facilitated glucose transporter member 12 OS=Homo sapiens GN=SLC2A12 PE=2 SV=1 158 453 2.0E-07
sp|Q8WMN1|GTR5_SHEEP Solute carrier family 2, facilitated glucose transporter member 5 OS=Ovis aries GN=SLC2A5 PE=2 SV=1 167 562 2.0E-07
sp|P49374|HGT1_KLULA High-affinity glucose transporter OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HGT1 PE=3 SV=1 203 595 2.0E-07
sp|Q46909|YGCS_ECOLI Inner membrane metabolite transport protein YgcS OS=Escherichia coli (strain K12) GN=ygcS PE=1 SV=2 167 553 2.0E-07
sp|Q9BE72|GTR12_MACFA Solute carrier family 2, facilitated glucose transporter member 12 OS=Macaca fascicularis GN=SLC2A12 PE=2 SV=1 158 453 4.0E-07
sp|B4LPX5|TRET1_DROVI Facilitated trehalose transporter Tret1 OS=Drosophila virilis GN=Tret1 PE=3 SV=2 174 552 4.0E-07
sp|O74713|HGT1_CANAX High-affinity glucose transporter OS=Candida albicans GN=HGT1 PE=3 SV=1 228 457 5.0E-07
sp|Q9P3U7|GHT8_SCHPO Probable high-affinity hexose transporter ght8, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght8 PE=1 SV=1 166 562 6.0E-07
sp|O44616|FGTH1_CAEEL Facilitated glucose transporter homolog OS=Caenorhabditis elegans GN=R09B5.11 PE=1 SV=2 202 437 8.0E-07
sp|Q9ZQP6|INT3_ARATH Probable inositol transporter 3 OS=Arabidopsis thaliana GN=INT3 PE=2 SV=1 161 441 9.0E-07
sp|P31679|YAAU_ECOLI Putative metabolite transport protein YaaU OS=Escherichia coli (strain K12) GN=yaaU PE=3 SV=2 153 554 1.0E-06
sp|Q17NV8|TRET1_AEDAE Facilitated trehalose transporter Tret1 OS=Aedes aegypti GN=Tret1 PE=3 SV=1 286 559 1.0E-06
sp|Q39228|STP4_ARATH Sugar transport protein 4 OS=Arabidopsis thaliana GN=STP4 PE=1 SV=1 166 431 1.0E-06
sp|P30606|ITR2_YEAST Myo-inositol transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR2 PE=1 SV=2 173 444 1.0E-06
sp|Q56ZZ7|PLST4_ARATH Plastidic glucose transporter 4 OS=Arabidopsis thaliana GN=At5g16150 PE=1 SV=2 162 560 1.0E-06
sp|Q9SBA7|STP8_ARATH Sugar transport protein 8 OS=Arabidopsis thaliana GN=STP8 PE=2 SV=2 179 554 1.0E-06
sp|Q3UHK1|MYCT_MOUSE Proton myo-inositol cotransporter OS=Mus musculus GN=Slc2a13 PE=1 SV=2 204 451 2.0E-06
sp|Q6NWF1|GTR12_DANRE Solute carrier family 2, facilitated glucose transporter member 12 OS=Danio rerio GN=slc2a12 PE=2 SV=2 185 449 2.0E-06
sp|P87110|ITR2_SCHPO Myo-inositol transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itr2 PE=2 SV=1 173 563 2.0E-06
sp|Q291H8|TRET1_DROPS Facilitated trehalose transporter Tret1 OS=Drosophila pseudoobscura pseudoobscura GN=Tret1 PE=3 SV=3 174 552 2.0E-06
sp|B4GAP7|TRET1_DROPE Facilitated trehalose transporter Tret1 OS=Drosophila persimilis GN=Tret1 PE=3 SV=2 174 552 2.0E-06
sp|Q9FRL3|ERDL6_ARATH Sugar transporter ERD6-like 6 OS=Arabidopsis thaliana GN=At1g75220 PE=1 SV=1 166 427 2.0E-06
sp|P96710|ARAE_BACSU Arabinose-proton symporter OS=Bacillus subtilis (strain 168) GN=araE PE=2 SV=2 175 561 2.0E-06
sp|Q921A2|MYCT_RAT Proton myo-inositol cotransporter OS=Rattus norvegicus GN=Slc2a13 PE=1 SV=2 204 441 2.0E-06
sp|Q9FMX3|STP11_ARATH Sugar transport protein 11 OS=Arabidopsis thaliana GN=STP11 PE=1 SV=1 171 553 3.0E-06
sp|B4QBN3|TRE12_DROSI Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila simulans GN=Tret1-2 PE=3 SV=1 97 588 3.0E-06
sp|Q9R1U7|S22A8_RAT Solute carrier family 22 member 8 OS=Rattus norvegicus GN=Slc22a8 PE=1 SV=1 158 426 3.0E-06
sp|O15245|S22A1_HUMAN Solute carrier family 22 member 1 OS=Homo sapiens GN=SLC22A1 PE=1 SV=2 194 554 3.0E-06
sp|B4HNS1|TRE12_DROSE Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila sechellia GN=Tret1-2 PE=3 SV=1 97 588 3.0E-06
sp|Q9M0Z9|EDL15_ARATH Sugar transporter ERD6-like 15 OS=Arabidopsis thaliana GN=At4g04760 PE=3 SV=2 166 567 4.0E-06
sp|B3NSE1|TRET1_DROER Facilitated trehalose transporter Tret1 OS=Drosophila erecta GN=Tret1 PE=3 SV=1 174 552 4.0E-06
sp|B3MG58|TRET1_DROAN Facilitated trehalose transporter Tret1 OS=Drosophila ananassae GN=Tret1 PE=3 SV=2 174 552 5.0E-06
sp|O23492|INT4_ARATH Inositol transporter 4 OS=Arabidopsis thaliana GN=INT4 PE=1 SV=1 212 445 5.0E-06
sp|B4P624|TRET1_DROYA Facilitated trehalose transporter Tret1 OS=Drosophila yakuba GN=Tret1 PE=3 SV=1 174 552 5.0E-06
sp|Q39525|HUP3_PARKE H(+)/hexose cotransporter 3 OS=Parachlorella kessleri GN=HUP3 PE=2 SV=1 106 444 7.0E-06
sp|Q91WU2|S22A7_MOUSE Solute carrier family 22 member 7 OS=Mus musculus GN=Slc22a7 PE=1 SV=1 286 497 8.0E-06
sp|P30605|ITR1_YEAST Myo-inositol transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR1 PE=1 SV=2 170 577 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 185 202 17
2 212 234 22
3 241 263 22
4 278 295 17
5 365 387 22
6 397 419 22
7 426 448 22
8 528 545 17

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup38
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1473
Ophiocordyceps australis 1348a (Ghana) OphauG2|683
Ophiocordyceps australis map64 (Brazil) OphauB2|1286
Ophiocordyceps australis map64 (Brazil) OphauB2|1397
Ophiocordyceps australis map64 (Brazil) OphauB2|5418
Ophiocordyceps camponoti-floridani Ophcf2|02934
Ophiocordyceps camponoti-floridani Ophcf2|06980
Ophiocordyceps camponoti-floridani Ophcf2|01832
Ophiocordyceps camponoti-floridani Ophcf2|02979
Ophiocordyceps camponoti-rufipedis Ophun1|1180
Ophiocordyceps camponoti-rufipedis Ophun1|1014
Ophiocordyceps camponoti-rufipedis Ophun1|7258 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2999
Ophiocordyceps kimflemingae Ophio5|1441
Ophiocordyceps kimflemingae Ophio5|3660
Ophiocordyceps kimflemingae Ophio5|7252
Ophiocordyceps kimflemingae Ophio5|8525
Ophiocordyceps subramaniannii Hirsu2|9948
Ophiocordyceps subramaniannii Hirsu2|6805
Ophiocordyceps subramaniannii Hirsu2|1776
Ophiocordyceps subramaniannii Hirsu2|10985

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7258
MTATTAKVDLPLPKSLGPDPWEDGTLEWETNGGLPDLNKLDTTTTISEDDSPFAKLRMMEESLWYSQKMGNSDPA
SEERSRGPSDKSLTFLQCCRKYPKALAWSGVLLTTMIAMSYSKSLIPAIISTPKFEREFGVPRNADDPSAGLIIE
PVWQIALQDASLATEIVGLMLCGPLTEVVGYRKMMIGSLIWTCIGFFPAVFFENLPTLLGSQIMLGISWGVIEIL
AFLYAAELVPHRLRAFVISSANMCWLIGRLLSAGFVAGFGDRSKDSSTARLPFVFQWVCAVPALLAVSYVPESPW
WLVRRGRLKDACLSLDRLSSRMNTDPDAAVALMNHTNKIEMKLKYGGARAIDMFKGTNRRRTEIACMVWICQAFS
GSSIISYAPYLMQRAGLEASASGTYATVMYGIAVAGGILSLFVVQYVGRRLLYLLGLGSAVIFLLVAGIVSIALP
PSYAVGWTLTALIIVTKLTSDLSIDPVRYILVTEIPAMRLRLNTVAFGRILYNICKIANNVIMPHMINPEVWDWK
GKVCFVYAGTSLAGFIWCYFRLPETKGLAHIEIDILFELKAPAKKFAVFRKQLEKTPYSSSVDHDKNPWHGWLSY
A*
Coding >Ophun1|7258
ATGACAGCAACGACCGCAAAAGTCGACCTGCCTTTGCCCAAGAGCCTCGGCCCGGATCCGTGGGAAGATGGCACC
CTCGAGTGGGAGACGAACGGCGGCTTGCCGGACCTGAACAAGCTGGACACGACGACGACAATCAGCGAAGATGAT
TCACCCTTTGCAAAGCTAAGGATGATGGAGGAGTCTCTCTGGTACTCGCAGAAGATGGGAAACTCGGATCCAGCC
AGCGAGGAGAGAAGCAGAGGCCCCTCGGACAAGAGCCTAACCTTTCTGCAATGCTGCCGCAAGTATCCAAAGGCC
CTGGCCTGGTCAGGCGTGCTCCTCACGACGATGATCGCCATGTCCTACAGCAAGTCTCTCATACCCGCCATCATC
TCGACGCCCAAGTTCGAGCGCGAGTTTGGCGTGCCGAGGAATGCTGATGACCCGTCGGCCGGCTTGATCATCGAG
CCTGTCTGGCAGATTGCGCTGCAGGATGCTTCTCTCGCGACGGAGATTGTGGGATTGATGCTGTGCGGTCCGCTG
ACGGAGGTTGTTGGCTACCGCAAGATGATGATTGGGAGCCTGATATGGACTTGTATTGGCTTCTTTCCGGCTGTG
TTCTTTGAGAATCTGCCGACGCTGCTGGGGTCGCAGATAATGCTTGGAATATCATGGGGAGTCATTGAGATCCTC
GCCTTCTTGTATGCAGCCGAGCTGGTGCCTCACCGACTGCGAGCCTTTGTCATTAGCAGCGCCAACATGTGCTGG
CTCATCGGCAGGCTCTTGTCTGCCGGATTCGTCGCTGGTTTCGGCGATAGGAGCAAGGACAGCTCGACGGCTAGG
CTGCCGTTTGTGTTTCAATGGGTTTGTGCGGTGCCTGCTCTGTTGGCCGTCTCCTATGTCCCGGAGAGTCCCTGG
TGGCTTGTACGCCGTGGCCGGTTAAAGGACGCCTGTCTTTCCCTCGACCGACTGTCCAGTAGGATGAATACCGAC
CCCGATGCAGCGGTGGCCTTGATGAATCACACCAACAAGATCGAGATGAAGCTCAAATACGGCGGAGCAAGAGCC
ATAGATATGTTCAAGGGGACGAACCGACGCCGTACCGAGATTGCCTGTATGGTCTGGATCTGTCAGGCCTTCTCC
GGCAGCTCCATCATCAGCTACGCGCCCTATCTCATGCAGCGTGCTGGGCTCGAGGCCTCGGCGTCCGGCACCTAC
GCAACCGTCATGTACGGCATTGCCGTGGCAGGGGGCATCCTATCTCTCTTTGTTGTCCAGTACGTCGGAAGACGA
CTTCTCTATCTCTTGGGCCTCGGATCAGCAGTCATCTTTCTCCTCGTCGCGGGCATCGTCTCTATTGCCCTCCCT
CCGAGCTACGCCGTCGGCTGGACCTTGACAGCCCTAATCATCGTCACAAAGCTCACGTCCGACCTCTCCATCGAT
CCCGTCCGCTACATCCTCGTCACCGAGATTCCCGCGATGCGTCTTCGTCTCAACACCGTCGCCTTTGGCAGGATA
CTCTACAACATCTGCAAGATCGCCAACAACGTCATCATGCCGCACATGATCAACCCCGAAGTCTGGGACTGGAAG
GGGAAAGTCTGCTTCGTCTACGCGGGCACTTCTCTCGCGGGCTTCATCTGGTGCTACTTCCGTTTGCCTGAGACA
AAGGGCCTCGCTCACATTGAGATTGACATTCTCTTTGAGCTCAAGGCTCCGGCAAAGAAGTTTGCTGTCTTTCGG
AAGCAGCTGGAGAAGACGCCGTATAGTTCGAGCGTGGATCACGACAAGAATCCATGGCATGGGTGGCTTTCGTAC
GCGTGA
Transcript >Ophun1|7258
ATGACAGCAACGACCGCAAAAGTCGACCTGCCTTTGCCCAAGAGCCTCGGCCCGGATCCGTGGGAAGATGGCACC
CTCGAGTGGGAGACGAACGGCGGCTTGCCGGACCTGAACAAGCTGGACACGACGACGACAATCAGCGAAGATGAT
TCACCCTTTGCAAAGCTAAGGATGATGGAGGAGTCTCTCTGGTACTCGCAGAAGATGGGAAACTCGGATCCAGCC
AGCGAGGAGAGAAGCAGAGGCCCCTCGGACAAGAGCCTAACCTTTCTGCAATGCTGCCGCAAGTATCCAAAGGCC
CTGGCCTGGTCAGGCGTGCTCCTCACGACGATGATCGCCATGTCCTACAGCAAGTCTCTCATACCCGCCATCATC
TCGACGCCCAAGTTCGAGCGCGAGTTTGGCGTGCCGAGGAATGCTGATGACCCGTCGGCCGGCTTGATCATCGAG
CCTGTCTGGCAGATTGCGCTGCAGGATGCTTCTCTCGCGACGGAGATTGTGGGATTGATGCTGTGCGGTCCGCTG
ACGGAGGTTGTTGGCTACCGCAAGATGATGATTGGGAGCCTGATATGGACTTGTATTGGCTTCTTTCCGGCTGTG
TTCTTTGAGAATCTGCCGACGCTGCTGGGGTCGCAGATAATGCTTGGAATATCATGGGGAGTCATTGAGATCCTC
GCCTTCTTGTATGCAGCCGAGCTGGTGCCTCACCGACTGCGAGCCTTTGTCATTAGCAGCGCCAACATGTGCTGG
CTCATCGGCAGGCTCTTGTCTGCCGGATTCGTCGCTGGTTTCGGCGATAGGAGCAAGGACAGCTCGACGGCTAGG
CTGCCGTTTGTGTTTCAATGGGTTTGTGCGGTGCCTGCTCTGTTGGCCGTCTCCTATGTCCCGGAGAGTCCCTGG
TGGCTTGTACGCCGTGGCCGGTTAAAGGACGCCTGTCTTTCCCTCGACCGACTGTCCAGTAGGATGAATACCGAC
CCCGATGCAGCGGTGGCCTTGATGAATCACACCAACAAGATCGAGATGAAGCTCAAATACGGCGGAGCAAGAGCC
ATAGATATGTTCAAGGGGACGAACCGACGCCGTACCGAGATTGCCTGTATGGTCTGGATCTGTCAGGCCTTCTCC
GGCAGCTCCATCATCAGCTACGCGCCCTATCTCATGCAGCGTGCTGGGCTCGAGGCCTCGGCGTCCGGCACCTAC
GCAACCGTCATGTACGGCATTGCCGTGGCAGGGGGCATCCTATCTCTCTTTGTTGTCCAGTACGTCGGAAGACGA
CTTCTCTATCTCTTGGGCCTCGGATCAGCAGTCATCTTTCTCCTCGTCGCGGGCATCGTCTCTATTGCCCTCCCT
CCGAGCTACGCCGTCGGCTGGACCTTGACAGCCCTAATCATCGTCACAAAGCTCACGTCCGACCTCTCCATCGAT
CCCGTCCGCTACATCCTCGTCACCGAGATTCCCGCGATGCGTCTTCGTCTCAACACCGTCGCCTTTGGCAGGATA
CTCTACAACATCTGCAAGATCGCCAACAACGTCATCATGCCGCACATGATCAACCCCGAAGTCTGGGACTGGAAG
GGGAAAGTCTGCTTCGTCTACGCGGGCACTTCTCTCGCGGGCTTCATCTGGTGCTACTTCCGTTTGCCTGAGACA
AAGGGCCTCGCTCACATTGAGATTGACATTCTCTTTGAGCTCAAGGCTCCGGCAAAGAAGTTTGCTGTCTTTCGG
AAGCAGCTGGAGAAGACGCCGTATAGTTCGAGCGTGGATCACGACAAGAATCCATGGCATGGGTGGCTTTCGTAC
GCGTGA
Gene >Ophun1|7258
ATGACAGCAACGACCGCAAAAGTCGACCTGCCTTTGCCCAAGAGCCTCGGCCCGGATCCGTGGGAAGATGGCACC
CTCGAGTGGGAGACGAACGGCGGCTTGCCGGACCTGAACAAGCTGGACACGACGACGACAATCAGCGAAGATGAT
TCACCCTTTGCAAAGCTAAGGATGATGGAGGAGTCTCTCTGGTACTCGCAGAAGATGGGAAACTCGGATCCAGCC
AGCGAGGAGAGAAGCAGAGGCCCCTCGGACAAGAGCCTAACCTTTCTGCAATGCTGCCGCAAGTATCCAAAGGCC
CTGGCCTGGTCAGGCGTGCTCCTCACGACGATGATCGCCATGTCCTACAGCAAGTCTCTCATACCCGCCATCATC
TCGACGCCCAAGTTCGAGCGCGAGTTTGGCGTGCCGAGGAATGCTGATGACCCGTCGGCCGGCTTGATCATCGAG
CCTGTCTGGCAGATTGCGCTGCAGGATGCTTCTCTCGCGACGGAGATTGTGGGATTGATGCTGTGCGGTCCGCTG
ACGGAGGTTGTTGGCTACCGCAAGATGATGATTGGGAGCCTGATATGGACTTGTATTGGCTTCTTTCCGGCTGTG
TTCTTTGAGAATCTGCCGACGCTGCTGGGGTCGCAGATAATGCTTGGTTCGTGCTTTCATCAATGACTGTATCTC
GAGTTTGACAGCTGTTGCTAATGCTAATGCTCAATCAGGAATATCATGGGGAGTCATTGAGATCCTCGCCTTCTT
GTATGCAGCCGAGCTGGTGCCTCACCGACTGCGAGCCTTTGTCATTAGCAGCGCCAACATGTGCTGGCTCATCGG
CAGGCTCTTGTCTGCCGGATTCGTCGCTGGTTTCGGCGATAGGAGCAAGGACAGCTCGACGGCTAGGCTGCCGTT
TGTGTTTCAATGGGTTTGTGCGGTGCCTGCTCTGTTGGCCGTCTCCTATGTCCCGGAGAGTCCCTGTGAGTGGTT
ACAACCGGCTGTACTGCTTTGATTCCATACTGACACCTTGTTTCAGGGTGGCTTGTACGCCGTGGCCGGTTAAAG
GACGCCTGTCTTTCCCTCGACCGACTGTCCAGTAGGATGAATACCGACCCCGATGCAGCGGTGGCCTTGATGAAT
CACACCAACAAGATCGAGATGAAGCTCAAATACGGCGGAGCAAGAGCCATAGATATGTTCAAGGGGACGAACCGA
CGCCGTACCGAGATTGCCTGTATGGTCTGGATCTGTCAGGCCTTCTCCGGCAGCTCCATCATCAGCTACGCGCCC
TATCTCATGCAGCGTGCTGGGCTCGAGGCCTCGGCGTCCGGCACCTACGCAACCGTCATGTACGGCATTGCCGTG
GCAGGGGGCATCCTATCTCTCTTTGTTGTCCAGTACGTCGGAAGACGACTTCTCTATCTCTTGGGCCTCGGATCA
GCAGTCATCTTTCTCCTCGTCGCGGGCATCGTCTCTATTGCCCTCCCTCCGAGCTACGCCGTCGGCTGGACCTTG
ACAGCCCTAATCATCGTCACAAAGCTCACGTCCGACCTCTCCATCGATCCCGTCCGCTACATCCTCGTCACCGAG
ATTCCCGCGATGCGTCTTCGTCTCAACACCGTCGCCTTTGGCAGGATACTCTACAACATCTGCAAGATCGCCAAC
AACGTCATCATGCCGCACATGATCAACCCCGAAGTCTGGGACTGGAAGGGGAAAGTCTGCTTCGTCTACGCGGGC
ACTTCTCTCGCGGGCTTCATCTGGTGCTACTTCCGTTTGCCTGAGACAAAGGGCCTCGCTCACATTGAGATTGAC
ATTCTCTTTGAGCTCAAGGCTCCGGCAAAGAAGTTTGCTGTCTTTCGGAAGCAGCTGGAGAAGACGCCGTATAGT
TCGAGCGTGGATCACGACAAGAATCCATGGCATGGGTGGCTTTCGTACGCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail