Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7252
Gene name
LocationContig_89:1525..3081
Strand+
Gene length (bp)1556
Transcript length (bp)1443
Coding sequence length (bp)1443
Protein length (aa) 481

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01222 ERG4_ERG24 Ergosterol biosynthesis ERG4/ERG24 family 8.3E-168 9 480

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38670|ERG24_NEUCR Delta(14)-sterol reductase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erg-3 PE=3 SV=1 2 480 0.0E+00
sp|O13597|ERG24_SEPLY Delta(14)-sterol reductase OS=Septoria lycopersici GN=ERG3 PE=3 SV=1 3 480 0.0E+00
sp|Q01447|ERG24_FUSSO Delta(14)-sterol reductase OS=Fusarium solani subsp. pisi PE=3 SV=1 2 480 0.0E+00
sp|P78575|ERG24_ASCIM Delta(14)-sterol reductase OS=Ascobolus immersus GN=ERG3 PE=3 SV=1 11 480 6.0E-129
sp|Q09195|ERG24_SCHPO Delta(14)-sterol reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg24 PE=2 SV=1 1 480 7.0E-120
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38670|ERG24_NEUCR Delta(14)-sterol reductase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erg-3 PE=3 SV=1 2 480 0.0E+00
sp|O13597|ERG24_SEPLY Delta(14)-sterol reductase OS=Septoria lycopersici GN=ERG3 PE=3 SV=1 3 480 0.0E+00
sp|Q01447|ERG24_FUSSO Delta(14)-sterol reductase OS=Fusarium solani subsp. pisi PE=3 SV=1 2 480 0.0E+00
sp|P78575|ERG24_ASCIM Delta(14)-sterol reductase OS=Ascobolus immersus GN=ERG3 PE=3 SV=1 11 480 6.0E-129
sp|Q09195|ERG24_SCHPO Delta(14)-sterol reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg24 PE=2 SV=1 1 480 7.0E-120
sp|Q14739|LBR_HUMAN Lamin-B receptor OS=Homo sapiens GN=LBR PE=1 SV=2 12 480 7.0E-97
sp|Q5R7H4|LBR_PONAB Lamin-B receptor OS=Pongo abelii GN=LBR PE=2 SV=1 12 480 1.0E-96
sp|Q3U9G9|LBR_MOUSE Lamin-B receptor OS=Mus musculus GN=Lbr PE=1 SV=2 12 480 5.0E-96
sp|O08984|LBR_RAT Lamin-B receptor OS=Rattus norvegicus GN=Lbr PE=1 SV=1 12 480 3.0E-93
sp|P32462|ERG24_YEAST Delta(14)-sterol reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG24 PE=1 SV=1 11 480 9.0E-93
sp|P23913|LBR_CHICK Lamin-B receptor OS=Gallus gallus GN=LBR PE=1 SV=1 12 473 9.0E-90
sp|Q71KT5|ERG24_MOUSE Delta(14)-sterol reductase OS=Mus musculus GN=Tm7sf2 PE=1 SV=2 95 480 1.0E-87
sp|O76062|ERG24_HUMAN Delta(14)-sterol reductase OS=Homo sapiens GN=TM7SF2 PE=2 SV=3 95 480 1.0E-86
sp|Q8WMV1|ERG24_BOVIN Delta(14)-sterol reductase OS=Bos taurus GN=TM7SF2 PE=1 SV=1 95 480 2.0E-82
sp|Q54PP1|ERG24_DICDI Delta(14)-sterol reductase OS=Dictyostelium discoideum GN=erg24 PE=3 SV=1 12 479 9.0E-67
sp|Q7SXF1|DHCR7_DANRE 7-dehydrocholesterol reductase OS=Danio rerio GN=dhcr7 PE=2 SV=1 43 480 2.0E-61
sp|Q7ZXH1|DHCR7_XENLA 7-dehydrocholesterol reductase OS=Xenopus laevis GN=dhcr7 PE=2 SV=1 27 480 2.0E-60
sp|Q6P4M0|DHCR7_XENTR 7-dehydrocholesterol reductase OS=Xenopus tropicalis GN=dhcr7 PE=2 SV=1 27 480 9.0E-59
sp|Q5E9J5|DHCR7_BOVIN 7-dehydrocholesterol reductase OS=Bos taurus GN=DHCR7 PE=2 SV=1 27 480 3.0E-58
sp|Q9UBM7|DHCR7_HUMAN 7-dehydrocholesterol reductase OS=Homo sapiens GN=DHCR7 PE=1 SV=1 27 480 3.0E-57
sp|O88455|DHCR7_MOUSE 7-dehydrocholesterol reductase OS=Mus musculus GN=Dhcr7 PE=1 SV=1 27 480 4.0E-57
sp|Q9Z2Z8|DHCR7_RAT 7-dehydrocholesterol reductase OS=Rattus norvegicus GN=Dhcr7 PE=2 SV=1 27 480 2.0E-56
sp|Q9LDR4|ERG24_ARATH Delta(14)-sterol reductase OS=Arabidopsis thaliana GN=FK PE=1 SV=2 73 480 4.0E-52
sp|Q5UQI4|DHCR7_MIMIV Probable 7-dehydrocholesterol reductase OS=Acanthamoeba polyphaga mimivirus GN=DHCR7 PE=3 SV=1 160 480 3.0E-51
sp|Q9LDU6|ST7R_ARATH 7-dehydrocholesterol reductase OS=Arabidopsis thaliana GN=DWF5 PE=1 SV=1 67 480 5.0E-48
sp|P25340|ERG4_YEAST Delta(24(24(1)))-sterol reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG4 PE=1 SV=2 8 480 4.0E-39
sp|P36209|STS1_SCHPO Delta(24(24(1)))-sterol reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sts1 PE=1 SV=2 12 480 2.0E-38
sp|Q8MLV1|LBR_DROME Lamin-B receptor OS=Drosophila melanogaster GN=LBR PE=1 SV=1 12 480 1.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0016126 sterol biosynthetic process Yes
GO:0016020 membrane Yes
GO:0016628 oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor Yes
GO:1901617 organic hydroxy compound biosynthetic process No
GO:0008610 lipid biosynthetic process No
GO:0044238 primary metabolic process No
GO:0006629 lipid metabolic process No
GO:0003824 catalytic activity No
GO:0009058 biosynthetic process No
GO:0008152 metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0016125 sterol metabolic process No
GO:0016627 oxidoreductase activity, acting on the CH-CH group of donors No
GO:1901615 organic hydroxy compound metabolic process No
GO:0110165 cellular anatomical entity No
GO:0006694 steroid biosynthetic process No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0008202 steroid metabolic process No
GO:0008150 biological_process No
GO:0016491 oxidoreductase activity No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22
2 70 92 22
3 121 143 22
4 153 175 22
5 245 264 19
6 284 303 19
7 315 334 19
8 428 447 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7252
MAPKSVAEHGYEFFGPPGAFGISFGLPLLVYAFTFACNDVSGCPAPALLRPSTLSLDQLKLQVGWPENGIWGLAS
WKATGALLAYYALNLVLYRVLPAAQTEGTVLASGGRLKYKLNTMYSNTMTLAVLAAGTIAQGADFAVWRFIDENY
VQLLTASIGISYAISTFVYVRSFGVKPGNKDGRELAAGGHSGNMLYDWFIGRELNPRVVVPLIGEVDIKEWCELR
PGMMGWIVLNCAWCVRQYRNYGYVTDSILCITAVQAVYTVDSWWNEAAILTTMDITTDGFGMMLAFGDLVWVPFV
YSLQTRYLSVHPRSLGPVGLVAMLSLIGLGFFIFRSANSQKNVFRTNPEDPSVSHLEYIETKTGSRLLTTGWWGV
ARHINYLGDWIQAWPYSLPTGLAGYQVLAAGTGSEGAYVMKDGREVVAGDAKGWGMVVTYFYIVYFAVLLIHRDR
RDDEKCQRKYGEDWTKYKKLVRWRIVPGLY*
Coding >Ophun1|7252
ATGGCGCCCAAGTCTGTTGCAGAGCACGGCTACGAATTCTTCGGACCCCCCGGGGCCTTTGGCATCTCCTTCGGC
CTGCCACTCCTCGTCTACGCCTTCACCTTTGCCTGCAACGATGTCTCAGGCTGTCCGGCGCCCGCTTTGCTCCGC
CCGTCGACGCTGTCTTTGGACCAGCTGAAGCTTCAGGTCGGCTGGCCCGAGAATGGCATCTGGGGTTTGGCCAGC
TGGAAGGCGACGGGCGCGCTATTGGCGTATTACGCCCTCAACCTCGTCCTGTACCGCGTGCTGCCTGCCGCTCAG
ACCGAAGGCACGGTTCTGGCCTCGGGTGGGCGACTCAAGTACAAGCTCAACACCATGTACTCCAATACGATGACT
CTCGCCGTGCTCGCTGCGGGCACTATTGCGCAAGGCGCCGACTTTGCCGTCTGGCGCTTCATCGACGAGAATTAC
GTGCAGCTGCTCACGGCGAGCATCGGCATCTCGTACGCTATATCCACCTTTGTCTACGTCCGCAGCTTCGGCGTC
AAGCCTGGCAACAAAGATGGCCGCGAGCTGGCGGCGGGCGGACACAGCGGCAACATGCTGTACGACTGGTTCATC
GGACGGGAGCTTAATCCCCGCGTCGTCGTGCCGCTCATCGGCGAGGTGGACATCAAGGAGTGGTGCGAGCTGCGA
CCGGGTATGATGGGCTGGATCGTGCTCAACTGCGCCTGGTGCGTCAGGCAGTATCGCAACTACGGTTACGTGACG
GATAGTATCTTGTGCATCACCGCCGTCCAGGCCGTTTACACGGTCGATTCGTGGTGGAACGAGGCGGCCATCCTG
ACGACCATGGACATTACCACCGATGGCTTCGGCATGATGCTGGCGTTTGGCGACCTGGTGTGGGTGCCGTTTGTC
TACTCGCTACAGACGCGCTATCTCTCGGTGCATCCGCGCTCGCTGGGACCCGTGGGCTTGGTGGCGATGCTCAGC
CTCATCGGCCTGGGCTTCTTCATCTTCCGGTCGGCCAACAGCCAGAAGAACGTATTTCGGACGAACCCCGAGGAC
CCCAGCGTCTCCCACCTCGAATACATCGAGACCAAGACAGGCAGCCGGCTGCTGACGACGGGCTGGTGGGGGGTG
GCGCGACACATCAACTACCTGGGCGACTGGATCCAGGCCTGGCCATACAGCCTGCCGACGGGCCTGGCCGGGTAC
CAGGTGCTGGCGGCCGGGACGGGCTCCGAGGGCGCCTACGTGATGAAGGACGGCCGCGAGGTGGTGGCTGGCGAT
GCCAAGGGCTGGGGCATGGTGGTGACGTACTTTTACATTGTCTACTTTGCCGTGCTGCTGATCCATCGCGACCGA
CGCGACGACGAAAAGTGTCAGCGCAAGTACGGCGAGGATTGGACCAAGTACAAGAAGCTCGTGCGATGGCGCATC
GTCCCGGGCCTGTACTGA
Transcript >Ophun1|7252
ATGGCGCCCAAGTCTGTTGCAGAGCACGGCTACGAATTCTTCGGACCCCCCGGGGCCTTTGGCATCTCCTTCGGC
CTGCCACTCCTCGTCTACGCCTTCACCTTTGCCTGCAACGATGTCTCAGGCTGTCCGGCGCCCGCTTTGCTCCGC
CCGTCGACGCTGTCTTTGGACCAGCTGAAGCTTCAGGTCGGCTGGCCCGAGAATGGCATCTGGGGTTTGGCCAGC
TGGAAGGCGACGGGCGCGCTATTGGCGTATTACGCCCTCAACCTCGTCCTGTACCGCGTGCTGCCTGCCGCTCAG
ACCGAAGGCACGGTTCTGGCCTCGGGTGGGCGACTCAAGTACAAGCTCAACACCATGTACTCCAATACGATGACT
CTCGCCGTGCTCGCTGCGGGCACTATTGCGCAAGGCGCCGACTTTGCCGTCTGGCGCTTCATCGACGAGAATTAC
GTGCAGCTGCTCACGGCGAGCATCGGCATCTCGTACGCTATATCCACCTTTGTCTACGTCCGCAGCTTCGGCGTC
AAGCCTGGCAACAAAGATGGCCGCGAGCTGGCGGCGGGCGGACACAGCGGCAACATGCTGTACGACTGGTTCATC
GGACGGGAGCTTAATCCCCGCGTCGTCGTGCCGCTCATCGGCGAGGTGGACATCAAGGAGTGGTGCGAGCTGCGA
CCGGGTATGATGGGCTGGATCGTGCTCAACTGCGCCTGGTGCGTCAGGCAGTATCGCAACTACGGTTACGTGACG
GATAGTATCTTGTGCATCACCGCCGTCCAGGCCGTTTACACGGTCGATTCGTGGTGGAACGAGGCGGCCATCCTG
ACGACCATGGACATTACCACCGATGGCTTCGGCATGATGCTGGCGTTTGGCGACCTGGTGTGGGTGCCGTTTGTC
TACTCGCTACAGACGCGCTATCTCTCGGTGCATCCGCGCTCGCTGGGACCCGTGGGCTTGGTGGCGATGCTCAGC
CTCATCGGCCTGGGCTTCTTCATCTTCCGGTCGGCCAACAGCCAGAAGAACGTATTTCGGACGAACCCCGAGGAC
CCCAGCGTCTCCCACCTCGAATACATCGAGACCAAGACAGGCAGCCGGCTGCTGACGACGGGCTGGTGGGGGGTG
GCGCGACACATCAACTACCTGGGCGACTGGATCCAGGCCTGGCCATACAGCCTGCCGACGGGCCTGGCCGGGTAC
CAGGTGCTGGCGGCCGGGACGGGCTCCGAGGGCGCCTACGTGATGAAGGACGGCCGCGAGGTGGTGGCTGGCGAT
GCCAAGGGCTGGGGCATGGTGGTGACGTACTTTTACATTGTCTACTTTGCCGTGCTGCTGATCCATCGCGACCGA
CGCGACGACGAAAAGTGTCAGCGCAAGTACGGCGAGGATTGGACCAAGTACAAGAAGCTCGTGCGATGGCGCATC
GTCCCGGGCCTGTACTGA
Gene >Ophun1|7252
ATGGCGCCCAAGTCTGTTGCAGAGCACGGCTACGAATTCTTCGGACCGTACGTCGTGCCGCTCCCGCCGACCGGC
TTCCGTCCGCGCTGACTTTCCGCCGCTGCAGCCCCGGGGCCTTTGGCATCTCCTTCGGCCTGCCACTCCTCGTCT
ACGCCTTCACCTTTGCCTGCAACGATGTCTCAGGCTGTCCGGCGCCCGCTTTGCTCCGCCCGTCGACGCTGTCTT
TGGACCAGCTGAAGCTTCAGGTCGGCTGGCCCGAGAATGGCATCTGGGGTTTGGCCAGCTGGAAGGCGACGGGCG
CGCTATTGGCGTATTACGCCCTCAACCTCGTCCTGTACCGCGTGCTGCCTGCCGCTCAGACCGAAGGCACGGTTC
TGGCCTCGGGTGGGCGACTCAAGTACAAGCTCAACAGTGAGTGACGTGGTCGAGCCCCGGAGTAGCATCATGCTG
ATTATTGGGTCGCAGCCATGTACTCCAATACGATGACTCTCGCCGTGCTCGCTGCGGGCACTATTGCGCAAGGCG
CCGACTTTGCCGTCTGGCGCTTCATCGACGAGAATTACGTGCAGCTGCTCACGGCGAGCATCGGCATCTCGTACG
CTATATCCACCTTTGTCTACGTCCGCAGCTTCGGCGTCAAGCCTGGCAACAAAGATGGCCGCGAGCTGGCGGCGG
GCGGACACAGCGGCAACATGCTGTACGACTGGTTCATCGGACGGGAGCTTAATCCCCGCGTCGTCGTGCCGCTCA
TCGGCGAGGTGGACATCAAGGAGTGGTGCGAGCTGCGACCGGGTATGATGGGCTGGATCGTGCTCAACTGCGCCT
GGTGCGTCAGGCAGTATCGCAACTACGGTTACGTGACGGATAGTATCTTGTGCATCACCGCCGTCCAGGCCGTTT
ACACGGTCGATTCGTGGTGGAACGAGGCGGCCATCCTGACGACCATGGACATTACCACCGATGGCTTCGGCATGA
TGCTGGCGTTTGGCGACCTGGTGTGGGTGCCGTTTGTCTACTCGCTACAGACGCGCTATCTCTCGGTGCATCCGC
GCTCGCTGGGACCCGTGGGCTTGGTGGCGATGCTCAGCCTCATCGGCCTGGGCTTCTTCATCTTCCGGTCGGCCA
ACAGCCAGAAGAACGTATTTCGGACGAACCCCGAGGACCCCAGCGTCTCCCACCTCGAATACATCGAGACCAAGA
CAGGCAGCCGGCTGCTGACGACGGGCTGGTGGGGGGTGGCGCGACACATCAACTACCTGGGCGACTGGATCCAGG
CCTGGCCATACAGCCTGCCGACGGGCCTGGCCGGGTACCAGGTGCTGGCGGCCGGGACGGGCTCCGAGGGCGCCT
ACGTGATGAAGGACGGCCGCGAGGTGGTGGCTGGCGATGCCAAGGGCTGGGGCATGGTGGTGACGTACTTTTACA
TTGTCTACTTTGCCGTGCTGCTGATCCATCGCGACCGACGCGACGACGAAAAGTGTCAGCGCAAGTACGGCGAGG
ATTGGACCAAGTACAAGAAGCTCGTGCGATGGCGCATCGTCCCGGGCCTGTACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail