Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7251
Gene name
LocationContig_89:402..777
Strand-
Gene length (bp)375
Transcript length (bp)375
Coding sequence length (bp)375
Protein length (aa) 125

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 20 0.999216

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3192
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2689
Ophiocordyceps australis map64 (Brazil) OphauB2|3991
Ophiocordyceps camponoti-floridani Ophcf2|06977
Ophiocordyceps camponoti-rufipedis Ophun1|7251 (this protein)
Ophiocordyceps kimflemingae Ophio5|7257
Ophiocordyceps subramaniannii Hirsu2|5733

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7251
MRRLRISVALLVGAVAAAVAGEAASSSTTTTAPACTATSSTGSGAFFDLRPDLAGPPNKAKDYRAKGYDYGSNFT
LNICGAVVEPVKDVVGVEKELWANVSAFYTAHGNVYSIGCDAGPSISMV*
Coding >Ophun1|7251
ATGCGCCGCCTCCGAATCTCCGTTGCCCTCCTGGTCGGCGCCGTCGCGGCCGCTGTCGCCGGCGAAGCTGCCTCT
TCCTCGACGACGACGACGGCGCCCGCCTGTACAGCGACTTCTTCCACCGGCAGCGGCGCCTTCTTCGACCTGCGC
CCAGACCTGGCCGGCCCGCCCAACAAGGCCAAGGACTACCGCGCCAAGGGATACGACTACGGGAGTAATTTCACC
CTCAACATCTGCGGCGCCGTCGTCGAACCCGTCAAGGATGTCGTCGGCGTCGAAAAGGAACTCTGGGCCAACGTC
AGCGCCTTTTACACGGCACACGGCAACGTCTACTCCATCGGGTGCGATGCCGGTCCTTCTATTTCCATGGTCTGA
Transcript >Ophun1|7251
ATGCGCCGCCTCCGAATCTCCGTTGCCCTCCTGGTCGGCGCCGTCGCGGCCGCTGTCGCCGGCGAAGCTGCCTCT
TCCTCGACGACGACGACGGCGCCCGCCTGTACAGCGACTTCTTCCACCGGCAGCGGCGCCTTCTTCGACCTGCGC
CCAGACCTGGCCGGCCCGCCCAACAAGGCCAAGGACTACCGCGCCAAGGGATACGACTACGGGAGTAATTTCACC
CTCAACATCTGCGGCGCCGTCGTCGAACCCGTCAAGGATGTCGTCGGCGTCGAAAAGGAACTCTGGGCCAACGTC
AGCGCCTTTTACACGGCACACGGCAACGTCTACTCCATCGGGTGCGATGCCGGTCCTTCTATTTCCATGGTCTGA
Gene >Ophun1|7251
ATGCGCCGCCTCCGAATCTCCGTTGCCCTCCTGGTCGGCGCCGTCGCGGCCGCTGTCGCCGGCGAAGCTGCCTCT
TCCTCGACGACGACGACGGCGCCCGCCTGTACAGCGACTTCTTCCACCGGCAGCGGCGCCTTCTTCGACCTGCGC
CCAGACCTGGCCGGCCCGCCCAACAAGGCCAAGGACTACCGCGCCAAGGGATACGACTACGGGAGTAATTTCACC
CTCAACATCTGCGGCGCCGTCGTCGAACCCGTCAAGGATGTCGTCGGCGTCGAAAAGGAACTCTGGGCCAACGTC
AGCGCCTTTTACACGGCACACGGCAACGTCTACTCCATCGGGTGCGATGCCGGTCCTTCTATTTCCATGGTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail