Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7247
Gene name
LocationContig_888:55..1000
Strand+
Gene length (bp)945
Transcript length (bp)870
Coding sequence length (bp)870
Protein length (aa) 290

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01553 Acyltransferase Acyltransferase 9.2E-33 96 218

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P33333|PLSC_YEAST Probable 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLC1 PE=1 SV=1 44 267 1.0E-64
sp|Q9US20|YLD2_SCHPO Uncharacterized acyltransferase C1851.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1851.02 PE=3 SV=1 35 280 1.0E-55
sp|Q22267|PLC2_CAEEL Putative 1-acyl-sn-glycerol-3-phosphate acyltransferase acl-2 OS=Caenorhabditis elegans GN=acl-2 PE=3 SV=1 19 280 6.0E-41
sp|O15120|PLCB_HUMAN 1-acyl-sn-glycerol-3-phosphate acyltransferase beta OS=Homo sapiens GN=AGPAT2 PE=1 SV=1 71 278 1.0E-36
sp|Q8K3K7|PLCB_MOUSE 1-acyl-sn-glycerol-3-phosphate acyltransferase beta OS=Mus musculus GN=Agpat2 PE=1 SV=1 75 266 6.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P33333|PLSC_YEAST Probable 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLC1 PE=1 SV=1 44 267 1.0E-64
sp|Q9US20|YLD2_SCHPO Uncharacterized acyltransferase C1851.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1851.02 PE=3 SV=1 35 280 1.0E-55
sp|Q22267|PLC2_CAEEL Putative 1-acyl-sn-glycerol-3-phosphate acyltransferase acl-2 OS=Caenorhabditis elegans GN=acl-2 PE=3 SV=1 19 280 6.0E-41
sp|O15120|PLCB_HUMAN 1-acyl-sn-glycerol-3-phosphate acyltransferase beta OS=Homo sapiens GN=AGPAT2 PE=1 SV=1 71 278 1.0E-36
sp|Q8K3K7|PLCB_MOUSE 1-acyl-sn-glycerol-3-phosphate acyltransferase beta OS=Mus musculus GN=Agpat2 PE=1 SV=1 75 266 6.0E-35
sp|Q99943|PLCA_HUMAN 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha OS=Homo sapiens GN=AGPAT1 PE=1 SV=2 75 279 7.0E-35
sp|Q95JH2|PLCA_BOVIN 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha OS=Bos taurus GN=AGPAT1 PE=2 SV=1 75 279 8.0E-35
sp|Q95JH0|PLCA_SHEEP 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha OS=Ovis aries GN=AGPAT1 PE=2 SV=1 75 279 5.0E-34
sp|Q93841|PLC1_CAEEL Putative 1-acyl-sn-glycerol-3-phosphate acyltransferase acl-1 OS=Caenorhabditis elegans GN=acl-1 PE=3 SV=2 16 266 3.0E-33
sp|O35083|PLCA_MOUSE 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha OS=Mus musculus GN=Agpat1 PE=1 SV=1 102 279 4.0E-29
sp|P44848|PLSC_HAEIN 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=plsC PE=3 SV=1 99 274 7.0E-28
sp|P0A257|PLSC_SALTY 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=plsC PE=3 SV=1 104 280 5.0E-25
sp|P0A258|PLSC_SALTI 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Salmonella typhi GN=plsC PE=3 SV=1 104 280 5.0E-25
sp|P26647|PLSC_ECOLI 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Escherichia coli (strain K12) GN=plsC PE=1 SV=1 104 280 3.0E-24
sp|Q42870|PLSC_LIMDO 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Limnanthes douglasii GN=PLSC PE=2 SV=1 86 269 1.0E-23
sp|Q42868|PLSC_LIMAL 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Limnanthes alba PE=2 SV=1 86 269 2.0E-22
sp|Q42670|PLSC_COCNU 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Cocos nucifera PE=1 SV=1 104 257 1.0E-17
sp|Q9LLY4|LPAT1_BRANA 1-acyl-sn-glycerol-3-phosphate acyltransferase 1, chloroplastic OS=Brassica napus GN=LPAT1 PE=2 SV=1 103 215 2.0E-15
sp|Q8GXU8|LPAT1_ARATH 1-acyl-sn-glycerol-3-phosphate acyltransferase 1, chloroplastic OS=Arabidopsis thaliana GN=LPAT1 PE=2 SV=1 103 245 3.0E-13
sp|O25903|PLSC_HELPY 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=plsC PE=3 SV=1 105 278 4.0E-13
sp|Q9ZJN8|PLSC_HELPJ 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=plsC PE=3 SV=1 105 274 7.0E-13
sp|Q59601|PLSC_NEIGO 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Neisseria gonorrhoeae GN=plsC PE=3 SV=1 108 223 4.0E-10
sp|Q9JU41|PLSC_NEIMA 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=plsC PE=3 SV=1 108 223 4.0E-10
sp|Q9JZ47|PLSC_NEIMB 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Neisseria meningitidis serogroup B (strain MC58) GN=plsC PE=3 SV=1 108 223 5.0E-10
sp|Q59188|PLSC_BORBU 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=plsC PE=3 SV=2 104 275 4.0E-09
sp|Q49402|PLSC_MYCGE Probable 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=plsC PE=3 SV=1 102 255 9.0E-08
sp|Q8L7R3|LPCT1_ARATH Lysophospholipid acyltransferase LPEAT1 OS=Arabidopsis thaliana GN=LPEAT1 PE=1 SV=1 97 218 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016746 acyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 5 27 22
2 40 62 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7247
MAADLLGLAVKILVGSIGLVMTLYLASTVLPVAGFAARVLAGYLSLTACGLFGTIASIVMTAAGCQHNAQWLTAR
SFQLLMRLATGITFTVEDASRTLKTVRPAVFVANHQTELDVLMLGAVFPQRCSVAAKSVLKHVPVLGWFMRLSGT
IFIDRGNAKGAREAMRGAAQEIRDKRQSVFMFPEGTRSYAREPVLLPFKKGAFHLAIQAGVPIVPCVVANYSHIL
CPRKLLFTSGTIPVKVLDPIPTKGLDASDVDELTRRTYDVMLREYALLSVKAQGRPMPVPASPR*
Coding >Ophun1|7247
ATGGCCGCCGACCTCCTCGGCCTCGCCGTAAAGATACTCGTCGGCAGCATCGGGCTCGTCATGACGCTCTACCTC
GCCTCGACGGTCCTCCCCGTCGCCGGATTCGCCGCCCGCGTTCTGGCGGGATACCTCTCGCTGACAGCCTGCGGC
CTCTTCGGCACCATTGCCTCCATCGTCATGACGGCAGCCGGATGCCAGCACAACGCCCAGTGGTTGACGGCCCGG
TCCTTTCAGCTGCTCATGAGGTTGGCCACGGGCATCACCTTTACCGTCGAGGACGCGAGCCGCACTCTGAAAACG
GTTCGGCCCGCCGTCTTCGTCGCCAATCATCAGACGGAGCTCGACGTCTTGATGCTGGGCGCCGTTTTTCCTCAG
CGGTGTAGCGTCGCGGCAAAGTCGGTTCTCAAGCATGTGCCCGTTCTCGGCTGGTTCATGCGTCTCAGCGGTACC
ATCTTCATCGACCGTGGCAACGCAAAGGGCGCTCGAGAGGCCATGCGCGGCGCTGCTCAGGAGATTCGCGATAAG
CGTCAGAGCGTCTTCATGTTTCCCGAAGGCACCAGAAGCTACGCCCGAGAACCCGTCCTCCTCCCCTTCAAGAAG
GGTGCTTTCCACCTCGCCATCCAGGCCGGCGTCCCCATCGTCCCCTGCGTCGTAGCAAACTACAGCCACATCCTC
TGCCCTAGGAAGCTTCTCTTTACATCCGGCACCATCCCCGTCAAAGTCCTCGATCCCATACCGACAAAAGGCCTC
GACGCCTCCGACGTCGACGAGCTCACCCGCCGCACCTACGACGTCATGCTCCGAGAATACGCCCTCCTATCCGTC
AAGGCCCAGGGCCGCCCGATGCCCGTGCCCGCCTCACCCCGCTGA
Transcript >Ophun1|7247
ATGGCCGCCGACCTCCTCGGCCTCGCCGTAAAGATACTCGTCGGCAGCATCGGGCTCGTCATGACGCTCTACCTC
GCCTCGACGGTCCTCCCCGTCGCCGGATTCGCCGCCCGCGTTCTGGCGGGATACCTCTCGCTGACAGCCTGCGGC
CTCTTCGGCACCATTGCCTCCATCGTCATGACGGCAGCCGGATGCCAGCACAACGCCCAGTGGTTGACGGCCCGG
TCCTTTCAGCTGCTCATGAGGTTGGCCACGGGCATCACCTTTACCGTCGAGGACGCGAGCCGCACTCTGAAAACG
GTTCGGCCCGCCGTCTTCGTCGCCAATCATCAGACGGAGCTCGACGTCTTGATGCTGGGCGCCGTTTTTCCTCAG
CGGTGTAGCGTCGCGGCAAAGTCGGTTCTCAAGCATGTGCCCGTTCTCGGCTGGTTCATGCGTCTCAGCGGTACC
ATCTTCATCGACCGTGGCAACGCAAAGGGCGCTCGAGAGGCCATGCGCGGCGCTGCTCAGGAGATTCGCGATAAG
CGTCAGAGCGTCTTCATGTTTCCCGAAGGCACCAGAAGCTACGCCCGAGAACCCGTCCTCCTCCCCTTCAAGAAG
GGTGCTTTCCACCTCGCCATCCAGGCCGGCGTCCCCATCGTCCCCTGCGTCGTAGCAAACTACAGCCACATCCTC
TGCCCTAGGAAGCTTCTCTTTACATCCGGCACCATCCCCGTCAAAGTCCTCGATCCCATACCGACAAAAGGCCTC
GACGCCTCCGACGTCGACGAGCTCACCCGCCGCACCTACGACGTCATGCTCCGAGAATACGCCCTCCTATCCGTC
AAGGCCCAGGGCCGCCCGATGCCCGTGCCCGCCTCACCCCGCTGA
Gene >Ophun1|7247
ATGGCCGCCGACCTCCTCGGCCTCGCCGTAAAGATACTCGTCGGCAGCATCGGGCTCGTCATGACGCTCTACCTC
GCCTCGACGGTCCTCCCCGTCGCCGGATTCGCCGCCCGCGTTCTGGCGGGATACCTCTCGCTGACAGCCTGCGGC
CTCTTCGGCACCATTGCCTCCATCGTCATGACGGCAGCCGGATGCCAGCACAACGCCCAGTGGTTGACGGCCCGG
TCCTTTCAGCTGCTCATGAGGTTGGCCACGGGCATCACCTTTACCGTCGAGGACGCGAGCCGCACTCTGAAAACG
GTTCGGCCCGCCGTCTTCGTCGCCAATCATCAGACGGAGCTCGACGTCTTGATGCTGGGCGCCGTTTTTCCTCAG
CGGTGTAGCGTCGCGGCAAAGTCGGTTCTCAAGCATGTGCCCGTTCTCGGCTGGTTCATGCGTCTCAGCGGTACC
ATCTTCATCGACCGTGGCAACGCAAAGGGCGCTCGAGAGGCCATGCGCGGCGCTGCTCAGGAGATTCGCGATAAG
CGTCAGAGCGTCTTCATGTTTCCCGAAGGCACCAGAAGCTACGCCCGAGAACCCGTCCTCCTCCCCTTCAAGAAG
GGTGCTTTCCACCTCGCCATCCAGGCCGGCGTCCCCATCGTCCCCTGCGTCGTAGCAAACTACAGCCACATCCTC
TGCCCTAGGAAGCTTCTCTTTACATCCGGCACCATCCCCGTCAAAGGTTTCCATCCTGCCTAAACTTCCCCTACC
TATTTACGTGACCTGGCTGACCTCTCCCGCCCCTTTACCCCCCCAGTCCTCGATCCCATACCGACAAAAGGCCTC
GACGCCTCCGACGTCGACGAGCTCACCCGCCGCACCTACGACGTCATGCTCCGAGAATACGCCCTCCTATCCGTC
AAGGCCCAGGGCCGCCCGATGCCCGTGCCCGCCTCACCCCGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail