Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7246
Gene name
LocationContig_887:4420..5966
Strand+
Gene length (bp)1546
Transcript length (bp)1482
Coding sequence length (bp)1482
Protein length (aa) 494

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 7.5E-36 111 443
PF00083 Sugar_tr Sugar (and other) transporter 2.0E-05 102 209

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08268|MCH4_YEAST Probable transporter MCH4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH4 PE=1 SV=1 42 480 7.0E-80
sp|Q08777|MCH5_YEAST Riboflavin transporter MCH5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH5 PE=1 SV=2 1 487 8.0E-76
sp|P36032|MCH2_YEAST Probable transporter MCH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH2 PE=1 SV=2 41 480 8.0E-27
sp|Q17QR6|MOT13_BOVIN Monocarboxylate transporter 13 OS=Bos taurus GN=SLC16A13 PE=2 SV=1 88 467 1.0E-26
sp|P53918|ESBP6_YEAST Uncharacterized transporter ESBP6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ESBP6 PE=1 SV=1 91 425 8.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08268|MCH4_YEAST Probable transporter MCH4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH4 PE=1 SV=1 42 480 7.0E-80
sp|Q08777|MCH5_YEAST Riboflavin transporter MCH5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH5 PE=1 SV=2 1 487 8.0E-76
sp|P36032|MCH2_YEAST Probable transporter MCH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH2 PE=1 SV=2 41 480 8.0E-27
sp|Q17QR6|MOT13_BOVIN Monocarboxylate transporter 13 OS=Bos taurus GN=SLC16A13 PE=2 SV=1 88 467 1.0E-26
sp|P53918|ESBP6_YEAST Uncharacterized transporter ESBP6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ESBP6 PE=1 SV=1 91 425 8.0E-26
sp|Q8CE94|MOT13_MOUSE Monocarboxylate transporter 13 OS=Mus musculus GN=Slc16a13 PE=2 SV=1 94 467 2.0E-25
sp|Q66HE2|MOT13_RAT Monocarboxylate transporter 13 OS=Rattus norvegicus GN=Slc16a13 PE=2 SV=1 90 467 1.0E-23
sp|A1L1W9|MOT10_DANRE Monocarboxylate transporter 10 OS=Danio rerio GN=slc16a10 PE=2 SV=1 71 475 2.0E-23
sp|P36021|MOT8_HUMAN Monocarboxylate transporter 8 OS=Homo sapiens GN=SLC16A2 PE=1 SV=2 55 483 3.0E-23
sp|Q8K1P8|MOT8_RAT Monocarboxylate transporter 8 OS=Rattus norvegicus GN=SLC16A2 PE=1 SV=1 72 483 3.0E-23
sp|Q6GM59|MOT12_XENLA Monocarboxylate transporter 12 OS=Xenopus laevis GN=slc16a12 PE=2 SV=1 81 481 8.0E-23
sp|O70324|MOT8_MOUSE Monocarboxylate transporter 8 OS=Mus musculus GN=Slc16a2 PE=1 SV=2 72 483 3.0E-22
sp|Q7RTY0|MOT13_HUMAN Monocarboxylate transporter 13 OS=Homo sapiens GN=SLC16A13 PE=2 SV=1 90 467 8.0E-22
sp|Q6P2X9|MOT12_XENTR Monocarboxylate transporter 12 OS=Xenopus tropicalis GN=slc16a12 PE=2 SV=1 81 492 6.0E-21
sp|O15427|MOT4_HUMAN Monocarboxylate transporter 4 OS=Homo sapiens GN=SLC16A3 PE=1 SV=1 94 487 3.0E-18
sp|O35910|MOT4_RAT Monocarboxylate transporter 4 OS=Rattus norvegicus GN=Slc16a3 PE=1 SV=1 94 467 5.0E-17
sp|Q8K1C7|MOT14_MOUSE Monocarboxylate transporter 14 OS=Mus musculus GN=Slc16a14 PE=2 SV=1 81 293 1.0E-16
sp|P57787|MOT4_MOUSE Monocarboxylate transporter 4 OS=Mus musculus GN=Slc16a3 PE=1 SV=1 94 467 4.0E-16
sp|Q503M4|MT12B_DANRE Monocarboxylate transporter 12-B OS=Danio rerio GN=slc16a12b PE=2 SV=1 94 466 1.0E-15
sp|P57788|MOT4_CHICK Monocarboxylate transporter 4 OS=Gallus gallus GN=SLC16A3 PE=2 SV=1 94 487 1.0E-15
sp|Q8BGC3|MOT12_MOUSE Monocarboxylate transporter 12 OS=Mus musculus GN=Slc16a12 PE=2 SV=1 94 474 2.0E-15
sp|Q8TF71|MOT10_HUMAN Monocarboxylate transporter 10 OS=Homo sapiens GN=SLC16A10 PE=1 SV=1 101 477 3.0E-15
sp|O70451|MOT2_MOUSE Monocarboxylate transporter 2 OS=Mus musculus GN=Slc16a7 PE=1 SV=1 86 480 5.0E-15
sp|Q7RTX9|MOT14_HUMAN Monocarboxylate transporter 14 OS=Homo sapiens GN=SLC16A14 PE=2 SV=1 100 302 5.0E-15
sp|Q63344|MOT2_RAT Monocarboxylate transporter 2 OS=Rattus norvegicus GN=Slc16a7 PE=1 SV=1 101 478 1.0E-14
sp|Q6ZSM3|MOT12_HUMAN Monocarboxylate transporter 12 OS=Homo sapiens GN=SLC16A12 PE=1 SV=2 90 481 2.0E-14
sp|Q91Y77|MOT10_RAT Monocarboxylate transporter 10 OS=Rattus norvegicus GN=Slc16a10 PE=1 SV=1 37 477 2.0E-14
sp|O60669|MOT2_HUMAN Monocarboxylate transporter 2 OS=Homo sapiens GN=SLC16A7 PE=1 SV=2 101 478 4.0E-14
sp|P53988|MOT2_MESAU Monocarboxylate transporter 2 OS=Mesocricetus auratus GN=SLC16A7 PE=1 SV=1 101 480 7.0E-14
sp|Q3U9N9|MOT10_MOUSE Monocarboxylate transporter 10 OS=Mus musculus GN=Slc16a10 PE=1 SV=1 75 477 8.0E-13
sp|P53985|MOT1_HUMAN Monocarboxylate transporter 1 OS=Homo sapiens GN=SLC16A1 PE=1 SV=3 92 406 8.0E-13
sp|P53986|MOT1_MOUSE Monocarboxylate transporter 1 OS=Mus musculus GN=Slc16a1 PE=1 SV=1 92 406 2.0E-12
sp|Q90632|MOT3_CHICK Monocarboxylate transporter 3 OS=Gallus gallus GN=SLC16A3 PE=2 SV=2 94 474 3.0E-12
sp|O35308|MOT3_MOUSE Monocarboxylate transporter 3 OS=Mus musculus GN=Slc16a8 PE=2 SV=2 103 353 6.0E-12
sp|B1AT66|MOT7_MOUSE Monocarboxylate transporter 7 OS=Mus musculus GN=Slc16a6 PE=1 SV=1 61 272 8.0E-12
sp|P53987|MOT1_RAT Monocarboxylate transporter 1 OS=Rattus norvegicus GN=Slc16a1 PE=1 SV=1 92 406 1.0E-11
sp|Q03064|MOT1_CRILO Monocarboxylate transporter 1 OS=Cricetulus longicaudatus GN=SLC16A1 PE=1 SV=1 92 406 2.0E-11
sp|Q3MHW6|MOT1_BOVIN Monocarboxylate transporter 1 OS=Bos taurus GN=SLC16A1 PE=2 SV=2 92 406 2.0E-11
sp|G5E8K6|MOT6_MOUSE Monocarboxylate transporter 6 OS=Mus musculus GN=Slc16a5 PE=3 SV=1 100 444 3.0E-11
sp|O15403|MOT7_HUMAN Monocarboxylate transporter 7 OS=Homo sapiens GN=SLC16A6 PE=1 SV=2 82 280 1.0E-10
sp|O70461|MOT3_RAT Monocarboxylate transporter 3 OS=Rattus norvegicus GN=Slc16a8 PE=2 SV=1 103 353 1.0E-10
sp|O95907|MOT3_HUMAN Monocarboxylate transporter 3 OS=Homo sapiens GN=SLC16A8 PE=2 SV=1 91 353 1.0E-09
sp|Q5ZJU0|MOT9_CHICK Monocarboxylate transporter 9 OS=Gallus gallus GN=SLC16A9 PE=2 SV=1 94 289 1.0E-07
sp|Q7TM99|MOT9_MOUSE Monocarboxylate transporter 9 OS=Mus musculus GN=Slc16a9 PE=2 SV=1 91 294 5.0E-07
sp|O15375|MOT6_HUMAN Monocarboxylate transporter 6 OS=Homo sapiens GN=SLC16A5 PE=2 SV=1 100 257 8.0E-07
sp|Q8R0M8|MOT5_MOUSE Monocarboxylate transporter 5 OS=Mus musculus GN=Slc16a4 PE=2 SV=1 80 256 4.0E-06
sp|Q5R5M4|MOT9_PONAB Monocarboxylate transporter 9 OS=Pongo abelii GN=SLC16A9 PE=2 SV=1 94 294 4.0E-06
sp|Q7RTY1|MOT9_HUMAN Monocarboxylate transporter 9 OS=Homo sapiens GN=SLC16A9 PE=1 SV=1 94 294 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 55 0.45

Transmembrane Domains

Domain # Start End Length
1 102 124 22
2 139 161 22
3 168 190 22
4 200 222 22
5 227 249 22
6 259 281 22
7 302 324 22
8 339 356 17
9 363 385 22
10 395 417 22
11 429 451 22
12 461 483 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7246
MDVHQVNSRALHDDDDDSAATATMTTTTTTAVVAAAAAVARNDDDDDDDDDDDDDDDDDDENGHRVRRQHQQDNA
DGDALEKRASSASYEETYPEGGLRAWLVVLGSWFAMVSSMGLMNTVGIFQAYTLRHQLRHHSEGTVGWIFSVYTF
LSFFCGVYIGPVFDKYGPRWLVIAGCASTFVGVLLLSFCQELWQFVLSFGVLAGFGTSLLFTPCIAAVGHWFRRR
RGFATGMASTAGGIGGIVFPLMLTSLFDSVGYGWATRALALACLACGLVGVALVRSRLPPAQDATAHPDLRILRQ
VPFTLTTVAIFLLEFSLFIPLTFISTYAMHEGFDQSFSFHLLPIMNAGSVVGRALPGYYADVVGPFNVCLASVLL
SLVACLCVWLPLGHTAAGIIVFSLIFGFASGTSIAIAPVCIGRMCKTRNYGRYYATTYTVVSFACLLGVPIGGSI
VRASGGSYTSLIVLTGAVYVGSALCMLMAKVWHLGWKRWLAVY*
Coding >Ophun1|7246
ATGGATGTGCATCAGGTCAATTCGCGGGCCTTGCACGATGATGACGATGATAGCGCGGCGACGGCGACGATGACG
ACGACGACGACTACGGCTGTTGTTGCTGCTGCTGCGGCTGTGGCGAGGAATGATGACGATGACGATGACGATGAC
GATGATGATGATGATGATGATGACGACGACGAGAATGGTCATCGTGTTCGTCGTCAACATCAGCAGGACAACGCC
GATGGCGACGCGCTCGAGAAGAGAGCCTCGTCCGCCTCTTACGAAGAGACCTATCCCGAGGGCGGCCTGCGGGCC
TGGCTCGTCGTCTTGGGAAGCTGGTTCGCCATGGTTTCGTCGATGGGGTTGATGAATACGGTTGGCATCTTCCAG
GCGTATACGCTGCGTCACCAGCTTCGCCATCACAGCGAGGGGACCGTCGGTTGGATCTTTTCCGTCTATACGTTT
CTATCCTTCTTCTGCGGCGTTTACATCGGTCCCGTCTTCGACAAGTACGGGCCTAGATGGCTGGTCATCGCCGGC
TGTGCGAGCACCTTTGTCGGCGTACTGCTACTGAGTTTCTGTCAAGAACTCTGGCAATTCGTCCTCTCCTTCGGC
GTCCTCGCCGGCTTCGGCACCTCCCTCCTCTTCACGCCCTGCATCGCAGCAGTAGGCCACTGGTTCCGCCGTCGA
CGCGGCTTCGCAACCGGCATGGCCTCCACAGCCGGCGGGATTGGCGGCATCGTCTTCCCCCTGATGCTCACCTCT
CTCTTCGACAGCGTCGGCTACGGATGGGCTACGCGCGCGCTGGCCCTCGCCTGTCTGGCCTGCGGACTCGTCGGC
GTTGCGCTCGTGCGCTCTCGTCTCCCGCCCGCTCAGGACGCTACCGCTCATCCCGATCTCCGCATCCTACGACAG
GTGCCCTTTACGCTGACGACGGTCGCCATCTTCCTGCTCGAGTTCTCGCTCTTCATCCCCCTGACCTTTATATCG
ACCTATGCCATGCACGAGGGCTTCGACCAATCCTTCTCCTTCCATCTCCTCCCCATCATGAACGCCGGCTCCGTC
GTCGGCCGCGCTTTACCAGGATACTACGCCGACGTCGTCGGCCCCTTCAACGTCTGCCTCGCCTCGGTCCTCCTC
TCACTGGTAGCCTGTCTCTGCGTCTGGCTACCGCTGGGCCACACAGCAGCCGGCATCATCGTCTTCTCCCTCATC
TTCGGCTTCGCCAGCGGAACCAGCATCGCCATCGCGCCCGTCTGCATAGGCCGCATGTGCAAGACGCGCAACTAC
GGCCGCTACTACGCCACCACCTACACCGTCGTCTCCTTCGCCTGCCTGCTGGGCGTTCCCATCGGGGGATCCATT
GTTCGGGCCAGCGGGGGGTCGTACACGAGTTTGATTGTGCTTACGGGGGCTGTTTACGTTGGATCTGCGCTTTGT
ATGCTCATGGCTAAGGTGTGGCATCTGGGGTGGAAGCGGTGGTTGGCCGTATATTGA
Transcript >Ophun1|7246
ATGGATGTGCATCAGGTCAATTCGCGGGCCTTGCACGATGATGACGATGATAGCGCGGCGACGGCGACGATGACG
ACGACGACGACTACGGCTGTTGTTGCTGCTGCTGCGGCTGTGGCGAGGAATGATGACGATGACGATGACGATGAC
GATGATGATGATGATGATGATGACGACGACGAGAATGGTCATCGTGTTCGTCGTCAACATCAGCAGGACAACGCC
GATGGCGACGCGCTCGAGAAGAGAGCCTCGTCCGCCTCTTACGAAGAGACCTATCCCGAGGGCGGCCTGCGGGCC
TGGCTCGTCGTCTTGGGAAGCTGGTTCGCCATGGTTTCGTCGATGGGGTTGATGAATACGGTTGGCATCTTCCAG
GCGTATACGCTGCGTCACCAGCTTCGCCATCACAGCGAGGGGACCGTCGGTTGGATCTTTTCCGTCTATACGTTT
CTATCCTTCTTCTGCGGCGTTTACATCGGTCCCGTCTTCGACAAGTACGGGCCTAGATGGCTGGTCATCGCCGGC
TGTGCGAGCACCTTTGTCGGCGTACTGCTACTGAGTTTCTGTCAAGAACTCTGGCAATTCGTCCTCTCCTTCGGC
GTCCTCGCCGGCTTCGGCACCTCCCTCCTCTTCACGCCCTGCATCGCAGCAGTAGGCCACTGGTTCCGCCGTCGA
CGCGGCTTCGCAACCGGCATGGCCTCCACAGCCGGCGGGATTGGCGGCATCGTCTTCCCCCTGATGCTCACCTCT
CTCTTCGACAGCGTCGGCTACGGATGGGCTACGCGCGCGCTGGCCCTCGCCTGTCTGGCCTGCGGACTCGTCGGC
GTTGCGCTCGTGCGCTCTCGTCTCCCGCCCGCTCAGGACGCTACCGCTCATCCCGATCTCCGCATCCTACGACAG
GTGCCCTTTACGCTGACGACGGTCGCCATCTTCCTGCTCGAGTTCTCGCTCTTCATCCCCCTGACCTTTATATCG
ACCTATGCCATGCACGAGGGCTTCGACCAATCCTTCTCCTTCCATCTCCTCCCCATCATGAACGCCGGCTCCGTC
GTCGGCCGCGCTTTACCAGGATACTACGCCGACGTCGTCGGCCCCTTCAACGTCTGCCTCGCCTCGGTCCTCCTC
TCACTGGTAGCCTGTCTCTGCGTCTGGCTACCGCTGGGCCACACAGCAGCCGGCATCATCGTCTTCTCCCTCATC
TTCGGCTTCGCCAGCGGAACCAGCATCGCCATCGCGCCCGTCTGCATAGGCCGCATGTGCAAGACGCGCAACTAC
GGCCGCTACTACGCCACCACCTACACCGTCGTCTCCTTCGCCTGCCTGCTGGGCGTTCCCATCGGGGGATCCATT
GTTCGGGCCAGCGGGGGGTCGTACACGAGTTTGATTGTGCTTACGGGGGCTGTTTACGTTGGATCTGCGCTTTGT
ATGCTCATGGCTAAGGTGTGGCATCTGGGGTGGAAGCGGTGGTTGGCCGTATATTGA
Gene >Ophun1|7246
ATGGATGTGCATCAGGTCAATTCGCGGGCCTTGCACGATGATGACGATGATAGCGCGGCGACGGCGACGATGACG
ACGACGACGACTACGGCTGTTGTTGCTGCTGCTGCGGCTGTGGCGAGGAATGATGACGATGACGATGACGATGAC
GATGATGATGATGATGATGATGACGACGACGAGAATGGTCATCGTGTTCGTCGTCAACATCAGCAGGACAACGCC
GATGGCGACGCGCTCGAGAAGAGAGCCTCGTCCGCCTCTTACGAAGAGACCTATCCCGAGGGCGGCCTGCGGGCC
TGGCTCGTCGTCTTGGGAAGCTGGTTCGCCATGGTTTCGTCGATGGGGTTGATGAATACGGTTGGCATCTTCCAG
GCGTATACGCTGCGTCACCAGCTTCGCCATCACAGCGAGGGGACCGTCGGTTGGATCTTTTCCGTCTATACGTTT
CTATCCTTCTTCTGCGGCGTTTACATCGGTCCCGTCTTCGACAAGTACGGGCCTAGATGGCTGGTCATCGCCGGC
TGTGCGAGCACCTTTGTCGGCGTACTGCTACTGAGTTTCTGTCAAGGTGACTGACCCCCTTTGATCCCTTGATGC
CTCCCATCGCAACTAACAAGCCCAATCAATCCCAGAACTCTGGCAATTCGTCCTCTCCTTCGGCGTCCTCGCCGG
CTTCGGCACCTCCCTCCTCTTCACGCCCTGCATCGCAGCAGTAGGCCACTGGTTCCGCCGTCGACGCGGCTTCGC
AACCGGCATGGCCTCCACAGCCGGCGGGATTGGCGGCATCGTCTTCCCCCTGATGCTCACCTCTCTCTTCGACAG
CGTCGGCTACGGATGGGCTACGCGCGCGCTGGCCCTCGCCTGTCTGGCCTGCGGACTCGTCGGCGTTGCGCTCGT
GCGCTCTCGTCTCCCGCCCGCTCAGGACGCTACCGCTCATCCCGATCTCCGCATCCTACGACAGGTGCCCTTTAC
GCTGACGACGGTCGCCATCTTCCTGCTCGAGTTCTCGCTCTTCATCCCCCTGACCTTTATATCGACCTATGCCAT
GCACGAGGGCTTCGACCAATCCTTCTCCTTCCATCTCCTCCCCATCATGAACGCCGGCTCCGTCGTCGGCCGCGC
TTTACCAGGATACTACGCCGACGTCGTCGGCCCCTTCAACGTCTGCCTCGCCTCGGTCCTCCTCTCACTGGTAGC
CTGTCTCTGCGTCTGGCTACCGCTGGGCCACACAGCAGCCGGCATCATCGTCTTCTCCCTCATCTTCGGCTTCGC
CAGCGGAACCAGCATCGCCATCGCGCCCGTCTGCATAGGCCGCATGTGCAAGACGCGCAACTACGGCCGCTACTA
CGCCACCACCTACACCGTCGTCTCCTTCGCCTGCCTGCTGGGCGTTCCCATCGGGGGATCCATTGTTCGGGCCAG
CGGGGGGTCGTACACGAGTTTGATTGTGCTTACGGGGGCTGTTTACGTTGGATCTGCGCTTTGTATGCTCATGGC
TAAGGTGTGGCATCTGGGGTGGAAGCGGTGGTTGGCCGTATATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail