Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7245
Gene name
LocationContig_887:2779..3574
Strand+
Gene length (bp)795
Transcript length (bp)741
Coding sequence length (bp)741
Protein length (aa) 247

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09429 Wbp11 WW domain binding protein 11 8.2E-24 4 78

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0006396 RNA processing Yes
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0016070 RNA metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0008152 metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009987 cellular process No
GO:0071704 organic substance metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0008150 biological_process No
GO:0044238 primary metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0044237 cellular metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1810
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7177
Ophiocordyceps australis map64 (Brazil) OphauB2|7415
Ophiocordyceps camponoti-floridani Ophcf2|06200
Ophiocordyceps camponoti-rufipedis Ophun1|7245 (this protein)
Ophiocordyceps kimflemingae Ophio5|3374
Ophiocordyceps subramaniannii Hirsu2|1779

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7245
MPKERNYNPVQAQRKADKAKAIKKGKAEVQERRNEKLARKNPDRIQRQIDDLKAGGEKLSRHQEQVLQGLERELK
AVTRAREALGDRAPTLGRGRDVLGKRRRDSNSSDSGPEVTAEVSSIPMPRDTPPPIPREALDRWHAKRRARRARE
TEQRGEAAEKKDEASARSETNKAEVAVEHKTVYESKPVMRDLYKEAQAAFVPQAVQIQMAKRRGLMEPEEADRLE
EEGKLQMRATVEDGKSDDDSR*
Coding >Ophun1|7245
ATGCCCAAAGAGCGCAACTACAATCCGGTGCAGGCCCAGCGCAAGGCGGACAAGGCGAAGGCCATTAAAAAAGGC
AAGGCTGAGGTGCAAGAACGGCGAAACGAGAAGCTCGCACGCAAGAACCCCGACCGTATCCAGCGGCAGATCGAT
GACCTCAAGGCGGGCGGCGAGAAGCTCTCGCGGCATCAGGAGCAGGTGCTTCAGGGGCTGGAGAGGGAGTTGAAG
GCGGTGACGCGGGCGAGGGAGGCTCTCGGTGATCGGGCGCCGACCCTGGGCCGTGGTCGCGACGTGCTCGGCAAG
AGGAGGCGCGACTCCAACAGCAGCGACAGCGGGCCGGAGGTGACGGCGGAGGTGAGCAGCATCCCCATGCCGCGG
GACACGCCGCCGCCGATCCCACGAGAGGCCCTGGACCGATGGCACGCGAAGCGAAGGGCACGTCGGGCCCGCGAG
ACGGAGCAGCGGGGCGAGGCTGCGGAGAAGAAGGACGAGGCCTCGGCCAGATCGGAGACGAACAAAGCGGAGGTG
GCGGTGGAGCACAAGACGGTCTACGAGTCCAAGCCGGTGATGCGCGACTTGTACAAGGAAGCCCAGGCCGCTTTC
GTGCCCCAGGCGGTGCAGATCCAGATGGCCAAGCGGCGTGGCTTGATGGAGCCCGAGGAGGCGGATCGGCTCGAG
GAGGAGGGCAAGCTGCAGATGAGGGCGACGGTGGAGGATGGCAAATCGGATGACGATTCCCGCTGA
Transcript >Ophun1|7245
ATGCCCAAAGAGCGCAACTACAATCCGGTGCAGGCCCAGCGCAAGGCGGACAAGGCGAAGGCCATTAAAAAAGGC
AAGGCTGAGGTGCAAGAACGGCGAAACGAGAAGCTCGCACGCAAGAACCCCGACCGTATCCAGCGGCAGATCGAT
GACCTCAAGGCGGGCGGCGAGAAGCTCTCGCGGCATCAGGAGCAGGTGCTTCAGGGGCTGGAGAGGGAGTTGAAG
GCGGTGACGCGGGCGAGGGAGGCTCTCGGTGATCGGGCGCCGACCCTGGGCCGTGGTCGCGACGTGCTCGGCAAG
AGGAGGCGCGACTCCAACAGCAGCGACAGCGGGCCGGAGGTGACGGCGGAGGTGAGCAGCATCCCCATGCCGCGG
GACACGCCGCCGCCGATCCCACGAGAGGCCCTGGACCGATGGCACGCGAAGCGAAGGGCACGTCGGGCCCGCGAG
ACGGAGCAGCGGGGCGAGGCTGCGGAGAAGAAGGACGAGGCCTCGGCCAGATCGGAGACGAACAAAGCGGAGGTG
GCGGTGGAGCACAAGACGGTCTACGAGTCCAAGCCGGTGATGCGCGACTTGTACAAGGAAGCCCAGGCCGCTTTC
GTGCCCCAGGCGGTGCAGATCCAGATGGCCAAGCGGCGTGGCTTGATGGAGCCCGAGGAGGCGGATCGGCTCGAG
GAGGAGGGCAAGCTGCAGATGAGGGCGACGGTGGAGGATGGCAAATCGGATGACGATTCCCGCTGA
Gene >Ophun1|7245
ATGCCCAAAGAGCGCAACTACAATCCGGTGCAGGCCCAGCGCAAGGCGGACAAGGCGAAGGCCATTAAAAAAGGT
ACGCACCTCGGGTGGGCAGGCCGGTAGCGGTCGCTAACCGACGGGTCCGCAGGCAAGGCTGAGGTGCAAGAACGG
CGAAACGAGAAGCTCGCACGCAAGAACCCCGACCGTATCCAGCGGCAGATCGATGACCTCAAGGCGGGCGGCGAG
AAGCTCTCGCGGCATCAGGAGCAGGTGCTTCAGGGGCTGGAGAGGGAGTTGAAGGCGGTGACGCGGGCGAGGGAG
GCTCTCGGTGATCGGGCGCCGACCCTGGGCCGTGGTCGCGACGTGCTCGGCAAGAGGAGGCGCGACTCCAACAGC
AGCGACAGCGGGCCGGAGGTGACGGCGGAGGTGAGCAGCATCCCCATGCCGCGGGACACGCCGCCGCCGATCCCA
CGAGAGGCCCTGGACCGATGGCACGCGAAGCGAAGGGCACGTCGGGCCCGCGAGACGGAGCAGCGGGGCGAGGCT
GCGGAGAAGAAGGACGAGGCCTCGGCCAGATCGGAGACGAACAAAGCGGAGGTGGCGGTGGAGCACAAGACGGTC
TACGAGTCCAAGCCGGTGATGCGCGACTTGTACAAGGAAGCCCAGGCCGCTTTCGTGCCCCAGGCGGTGCAGATC
CAGATGGCCAAGCGGCGTGGCTTGATGGAGCCCGAGGAGGCGGATCGGCTCGAGGAGGAGGGCAAGCTGCAGATG
AGGGCGACGGTGGAGGATGGCAAATCGGATGACGATTCCCGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail