Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7244
Gene name
LocationContig_886:4484..4828
Strand-
Gene length (bp)344
Transcript length (bp)285
Coding sequence length (bp)285
Protein length (aa) 95

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF19117 Mim2 Mitochondrial import 2 2.2E-24 24 68

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|G2TRP0|TAM7_SCHPO Uncharacterized protein tam7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tam7 PE=2 SV=1 17 67 7.0E-08

GO

GO Term Description Terminal node
GO:0070096 mitochondrial outer membrane translocase complex assembly Yes
GO:0045040 protein insertion into mitochondrial outer membrane Yes
GO:0033365 protein localization to organelle No
GO:0061024 membrane organization No
GO:0051179 localization No
GO:0033036 macromolecule localization No
GO:0071705 nitrogen compound transport No
GO:0051649 establishment of localization in cell No
GO:0071840 cellular component organization or biogenesis No
GO:0006839 mitochondrial transport No
GO:0072655 establishment of protein localization to mitochondrion No
GO:0022607 cellular component assembly No
GO:0070585 protein localization to mitochondrion No
GO:0043933 protein-containing complex organization No
GO:0051234 establishment of localization No
GO:0046907 intracellular transport No
GO:0090150 establishment of protein localization to membrane No
GO:0008104 protein localization No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0008150 biological_process No
GO:0007005 mitochondrion organization No
GO:0007008 outer mitochondrial membrane organization No
GO:0071702 organic substance transport No
GO:0016043 cellular component organization No
GO:0051668 localization within membrane No
GO:0051641 cellular localization No
GO:0051205 protein insertion into membrane No
GO:0006996 organelle organization No
GO:0051204 protein insertion into mitochondrial membrane No
GO:0007006 mitochondrial membrane organization No
GO:0072657 protein localization to membrane No
GO:0006886 intracellular protein transport No
GO:0045184 establishment of protein localization No
GO:0015031 protein transport No
GO:0070727 cellular macromolecule localization No
GO:0090151 establishment of protein localization to mitochondrial membrane No
GO:0072594 establishment of protein localization to organelle No
GO:0065003 protein-containing complex assembly No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5205
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7946
Ophiocordyceps australis map64 (Brazil) OphauB2|4974
Ophiocordyceps camponoti-floridani Ophcf2|02122
Ophiocordyceps camponoti-rufipedis Ophun1|7244 (this protein)
Ophiocordyceps kimflemingae Ophio5|6051
Ophiocordyceps subramaniannii Hirsu2|4129

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7244
MADSDDVDSLPSLSTTDIYSESESDAQAEWERSLEQLQLVLTMMLVPWLGKYFGRKFAYWSWARYMEWMHNVEVR
WTNKRFFEAAGVVGAATVL*
Coding >Ophun1|7244
ATGGCCGACTCGGACGACGTCGACTCGCTGCCGTCGCTCTCGACGACCGACATTTACTCCGAGTCCGAGTCGGAC
GCGCAGGCCGAGTGGGAGCGCAGCCTGGAGCAGCTGCAGCTGGTGCTGACCATGATGCTGGTGCCGTGGCTGGGG
AAGTACTTTGGCCGCAAGTTTGCCTACTGGAGCTGGGCTCGCTACATGGAATGGATGCACAACGTCGAGGTTCGA
TGGACCAACAAGCGCTTCTTCGAGGCGGCGGGTGTCGTCGGGGCGGCTACGGTCTTGTGA
Transcript >Ophun1|7244
ATGGCCGACTCGGACGACGTCGACTCGCTGCCGTCGCTCTCGACGACCGACATTTACTCCGAGTCCGAGTCGGAC
GCGCAGGCCGAGTGGGAGCGCAGCCTGGAGCAGCTGCAGCTGGTGCTGACCATGATGCTGGTGCCGTGGCTGGGG
AAGTACTTTGGCCGCAAGTTTGCCTACTGGAGCTGGGCTCGCTACATGGAATGGATGCACAACGTCGAGGTTCGA
TGGACCAACAAGCGCTTCTTCGAGGCGGCGGGTGTCGTCGGGGCGGCTACGGTCTTGTGA
Gene >Ophun1|7244
ATGGCCGACTCGGACGACGTCGACTCGCTGCCGTCGCTCTCGACGACCGACATTTACTCCGAGTCCGAGTCGGAC
GCGCAGGCCGAGTGGGAGCGCAGCCTGGAGCAGCTGCAGCTGGTGCTGACCATGATGCTGGTGCCGTGGCTGGGG
AAGTACTTTGGCCGCAAGTTTGCCTACTGGAGTGAGTCTCACGGGGACCAAATCGATAGCCGTCATGGCAGCTGA
CGAGGCAATAACCAGGCTGGGCTCGCTACATGGAATGGATGCACAACGTCGAGGTTCGATGGACCAACAAGCGCT
TCTTCGAGGCGGCGGGTGTCGTCGGGGCGGCTACGGTCTTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail