Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7243
Gene name
LocationContig_886:3790..4300
Strand+
Gene length (bp)510
Transcript length (bp)510
Coding sequence length (bp)510
Protein length (aa) 170

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01284 MARVEL Membrane-associating domain 2.2E-16 7 145

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q12207|NCE2_YEAST Non-classical export protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NCE102 PE=1 SV=1 1 168 7.0E-16
sp|Q5ANE3|NCE2_CANAL Non-classical export protein 102 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NCE102 PE=1 SV=1 1 168 3.0E-10
sp|P53279|FHN1_YEAST Non-classical export protein 2 homolog 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FHN1 PE=1 SV=1 1 168 1.0E-09

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 39 61 22
3 66 88 22
4 130 152 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7243
MVDCGQLISRISALIWVLLATAVIGNVLQCNINGYMAPINFAMFCCALAWFPALYGFFASFIPAMVFPVIMIPLD
ALAVFFTFVAAVVLAGTLGAPNCGDLHYARHGRHWIGWGAKNDVKRCRELQASTAFMWFLWVSLSFGLVFSIRSA
GSLSFRRRYYPRPNMSQVA*
Coding >Ophun1|7243
ATGGTCGACTGCGGCCAGCTCATCTCGCGCATCAGCGCCCTCATCTGGGTCCTGCTCGCCACCGCCGTCATCGGA
AACGTGCTGCAATGCAACATCAACGGCTACATGGCCCCCATCAACTTCGCCATGTTCTGCTGCGCCCTGGCCTGG
TTCCCGGCTTTATACGGCTTCTTCGCCTCCTTCATACCCGCCATGGTCTTCCCCGTCATCATGATTCCCCTCGAC
GCCCTCGCCGTCTTCTTCACCTTTGTCGCCGCCGTCGTTCTGGCCGGCACCCTGGGCGCTCCCAACTGCGGCGAC
CTGCACTATGCTCGTCATGGACGGCATTGGATCGGCTGGGGAGCAAAGAACGATGTCAAGCGCTGCCGTGAGCTT
CAGGCCAGCACCGCCTTCATGTGGTTTCTCTGGGTCAGCCTGTCGTTTGGCCTCGTCTTCAGCATCAGGTCCGCG
GGGAGTCTGAGCTTCCGTCGTCGGTATTACCCGCGGCCCAACATGTCACAGGTGGCGTAG
Transcript >Ophun1|7243
ATGGTCGACTGCGGCCAGCTCATCTCGCGCATCAGCGCCCTCATCTGGGTCCTGCTCGCCACCGCCGTCATCGGA
AACGTGCTGCAATGCAACATCAACGGCTACATGGCCCCCATCAACTTCGCCATGTTCTGCTGCGCCCTGGCCTGG
TTCCCGGCTTTATACGGCTTCTTCGCCTCCTTCATACCCGCCATGGTCTTCCCCGTCATCATGATTCCCCTCGAC
GCCCTCGCCGTCTTCTTCACCTTTGTCGCCGCCGTCGTTCTGGCCGGCACCCTGGGCGCTCCCAACTGCGGCGAC
CTGCACTATGCTCGTCATGGACGGCATTGGATCGGCTGGGGAGCAAAGAACGATGTCAAGCGCTGCCGTGAGCTT
CAGGCCAGCACCGCCTTCATGTGGTTTCTCTGGGTCAGCCTGTCGTTTGGCCTCGTCTTCAGCATCAGGTCCGCG
GGGAGTCTGAGCTTCCGTCGTCGGTATTACCCGCGGCCCAACATGTCACAGGTGGCGTAG
Gene >Ophun1|7243
ATGGTCGACTGCGGCCAGCTCATCTCGCGCATCAGCGCCCTCATCTGGGTCCTGCTCGCCACCGCCGTCATCGGA
AACGTGCTGCAATGCAACATCAACGGCTACATGGCCCCCATCAACTTCGCCATGTTCTGCTGCGCCCTGGCCTGG
TTCCCGGCTTTATACGGCTTCTTCGCCTCCTTCATACCCGCCATGGTCTTCCCCGTCATCATGATTCCCCTCGAC
GCCCTCGCCGTCTTCTTCACCTTTGTCGCCGCCGTCGTTCTGGCCGGCACCCTGGGCGCTCCCAACTGCGGCGAC
CTGCACTATGCTCGTCATGGACGGCATTGGATCGGCTGGGGAGCAAAGAACGATGTCAAGCGCTGCCGTGAGCTT
CAGGCCAGCACCGCCTTCATGTGGTTTCTCTGGGTCAGCCTGTCGTTTGGCCTCGTCTTCAGCATCAGGTCCGCG
GGGAGTCTGAGCTTCCGTCGTCGGTATTACCCGCGGCCCAACATGTCACAGGTGGCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail