Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7240
Gene name
LocationContig_885:87..619
Strand+
Gene length (bp)532
Transcript length (bp)456
Coding sequence length (bp)456
Protein length (aa) 152

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00156 Pribosyltran Phosphoribosyl transferase domain 2.7E-13 29 122

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6CA53|APT_YARLI Adenine phosphoribosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=APT1 PE=3 SV=1 1 139 8.0E-43
sp|O42842|APT_SCHPO Adenine phosphoribosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=apt1 PE=3 SV=1 1 148 2.0E-40
sp|Q6BZF9|APT_DEBHA Adenine phosphoribosyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=APT1 PE=3 SV=1 1 139 4.0E-38
sp|P49435|APT1_YEAST Adenine phosphoribosyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APT1 PE=1 SV=3 1 140 4.0E-37
sp|Q6CWV0|APT_KLULA Adenine phosphoribosyltransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=APT1 PE=3 SV=1 1 139 9.0E-36
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6CA53|APT_YARLI Adenine phosphoribosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=APT1 PE=3 SV=1 1 139 8.0E-43
sp|O42842|APT_SCHPO Adenine phosphoribosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=apt1 PE=3 SV=1 1 148 2.0E-40
sp|Q6BZF9|APT_DEBHA Adenine phosphoribosyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=APT1 PE=3 SV=1 1 139 4.0E-38
sp|P49435|APT1_YEAST Adenine phosphoribosyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APT1 PE=1 SV=3 1 140 4.0E-37
sp|Q6CWV0|APT_KLULA Adenine phosphoribosyltransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=APT1 PE=3 SV=1 1 139 9.0E-36
sp|B7GR20|APT_BIFLS Adenine phosphoribosyltransferase OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=apt PE=3 SV=1 1 148 2.0E-35
sp|B3DRY2|APT_BIFLD Adenine phosphoribosyltransferase OS=Bifidobacterium longum (strain DJO10A) GN=apt PE=3 SV=1 1 148 3.0E-34
sp|B7JVC2|APT_CYAP8 Adenine phosphoribosyltransferase OS=Cyanothece sp. (strain PCC 8801) GN=apt PE=3 SV=1 14 149 4.0E-34
sp|Q8G6B5|APT_BIFLO Adenine phosphoribosyltransferase OS=Bifidobacterium longum (strain NCC 2705) GN=apt PE=3 SV=1 1 148 1.0E-33
sp|Q5ALX8|APT_CANAL Adenine phosphoribosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=APT1 PE=3 SV=1 1 139 1.0E-33
sp|P54363|APT_DROPS Adenine phosphoribosyltransferase OS=Drosophila pseudoobscura pseudoobscura GN=Aprt PE=3 SV=1 10 139 1.0E-33
sp|B9DUP2|APT_STRU0 Adenine phosphoribosyltransferase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=apt PE=3 SV=1 30 149 5.0E-33
sp|C0MDK3|APT_STRS7 Adenine phosphoribosyltransferase OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=apt PE=3 SV=1 2 148 6.0E-33
sp|B4U3L7|APT_STREM Adenine phosphoribosyltransferase OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=apt PE=3 SV=1 2 148 6.0E-33
sp|C0MAM5|APT_STRE4 Adenine phosphoribosyltransferase OS=Streptococcus equi subsp. equi (strain 4047) GN=apt PE=3 SV=1 2 148 6.0E-33
sp|B8DUE5|APT_BIFA0 Adenine phosphoribosyltransferase OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=apt PE=3 SV=1 1 148 7.0E-33
sp|B1WQD7|APT_CYAA5 Adenine phosphoribosyltransferase OS=Cyanothece sp. (strain ATCC 51142) GN=apt PE=3 SV=1 14 149 1.0E-32
sp|B0JR14|APT_MICAN Adenine phosphoribosyltransferase OS=Microcystis aeruginosa (strain NIES-843) GN=apt PE=3 SV=1 14 149 1.0E-32
sp|Q1IKJ1|APT_KORVE Adenine phosphoribosyltransferase OS=Koribacter versatilis (strain Ellin345) GN=apt PE=3 SV=1 30 148 1.0E-32
sp|B2A0H0|APT_NATTJ Adenine phosphoribosyltransferase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=apt PE=3 SV=1 28 147 2.0E-32
sp|Q756E2|APT_ASHGO Adenine phosphoribosyltransferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=APT1 PE=3 SV=1 1 139 2.0E-32
sp|B7KKQ8|APT_CYAP7 Adenine phosphoribosyltransferase OS=Cyanothece sp. (strain PCC 7424) GN=apt PE=3 SV=1 29 149 9.0E-32
sp|P73935|APT_SYNY3 Adenine phosphoribosyltransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=apt PE=3 SV=1 28 141 9.0E-32
sp|A1A1K5|APT_BIFAA Adenine phosphoribosyltransferase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=apt PE=3 SV=1 1 148 2.0E-31
sp|C1CLS6|APT_STRZP Adenine phosphoribosyltransferase OS=Streptococcus pneumoniae (strain P1031) GN=apt PE=3 SV=1 30 148 2.0E-31
sp|P63545|APT_STRR6 Adenine phosphoribosyltransferase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=apt PE=3 SV=1 30 148 2.0E-31
sp|P63544|APT_STRPN Adenine phosphoribosyltransferase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=apt PE=1 SV=1 30 148 2.0E-31
sp|B8ZLT9|APT_STRPJ Adenine phosphoribosyltransferase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=apt PE=3 SV=1 30 148 2.0E-31
sp|B1ICZ7|APT_STRPI Adenine phosphoribosyltransferase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=apt PE=3 SV=1 30 148 2.0E-31
sp|C1C8G8|APT_STRP7 Adenine phosphoribosyltransferase OS=Streptococcus pneumoniae (strain 70585) GN=apt PE=3 SV=1 30 148 2.0E-31
sp|Q04JH1|APT_STRP2 Adenine phosphoribosyltransferase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=apt PE=3 SV=2 30 148 2.0E-31
sp|Q9CHT5|APT_LACLA Adenine phosphoribosyltransferase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=apt PE=3 SV=2 30 148 2.0E-31
sp|C1CSJ8|APT_STRZT Adenine phosphoribosyltransferase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=apt PE=3 SV=1 30 148 2.0E-31
sp|B6IT90|APT_RHOCS Adenine phosphoribosyltransferase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=apt PE=3 SV=1 9 139 3.0E-31
sp|Q47N45|APT_THEFY Adenine phosphoribosyltransferase OS=Thermobifida fusca (strain YX) GN=apt PE=3 SV=1 2 143 3.0E-31
sp|A3DF48|APT_CLOTH Adenine phosphoribosyltransferase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=apt PE=3 SV=1 30 139 3.0E-31
sp|P91455|APT_CAEEL Adenine phosphoribosyltransferase OS=Caenorhabditis elegans GN=T19B4.3 PE=2 SV=1 1 148 5.0E-31
sp|B5E6M0|APT_STRP4 Adenine phosphoribosyltransferase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=apt PE=3 SV=1 30 148 6.0E-31
sp|A2RIW0|APT_LACLM Adenine phosphoribosyltransferase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=apt PE=3 SV=1 30 148 8.0E-31
sp|Q031A0|APT_LACLS Adenine phosphoribosyltransferase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=apt PE=3 SV=1 30 148 1.0E-30
sp|B1XL39|APT_SYNP2 Adenine phosphoribosyltransferase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=apt PE=3 SV=1 29 148 2.0E-30
sp|Q8DT95|APT_STRMU Adenine phosphoribosyltransferase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=apt PE=3 SV=1 2 149 2.0E-30
sp|A4VVY4|APT_STRSY Adenine phosphoribosyltransferase OS=Streptococcus suis (strain 05ZYH33) GN=apt PE=3 SV=1 30 148 3.0E-30
sp|A4W292|APT_STRS2 Adenine phosphoribosyltransferase OS=Streptococcus suis (strain 98HAH33) GN=apt PE=3 SV=1 30 148 3.0E-30
sp|Q03K92|APT_STRTD Adenine phosphoribosyltransferase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=apt PE=3 SV=1 30 149 3.0E-30
sp|Q5M3Y6|APT_STRT2 Adenine phosphoribosyltransferase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=apt PE=3 SV=1 30 149 3.0E-30
sp|Q5LZD4|APT_STRT1 Adenine phosphoribosyltransferase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=apt PE=3 SV=1 30 149 3.0E-30
sp|Q5FSN7|APT_GLUOX Adenine phosphoribosyltransferase OS=Gluconobacter oxydans (strain 621H) GN=apt PE=3 SV=1 29 150 4.0E-30
sp|P12426|APT_DROME Adenine phosphoribosyltransferase OS=Drosophila melanogaster GN=Aprt PE=2 SV=3 10 148 5.0E-30
sp|C1F3T2|APT_ACIC5 Adenine phosphoribosyltransferase OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=apt PE=3 SV=1 11 148 5.0E-30
sp|A3CNR3|APT_STRSV Adenine phosphoribosyltransferase OS=Streptococcus sanguinis (strain SK36) GN=apt PE=3 SV=1 30 148 7.0E-30
sp|Q3K0P8|APT_STRA1 Adenine phosphoribosyltransferase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=apt PE=3 SV=1 30 149 7.0E-30
sp|Q97GU0|APT_CLOAB Adenine phosphoribosyltransferase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=apt PE=3 SV=1 30 148 9.0E-30
sp|B5XL39|APT_STRPZ Adenine phosphoribosyltransferase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=apt PE=3 SV=1 30 148 1.0E-29
sp|P0CZ63|APT_STRPQ Adenine phosphoribosyltransferase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=apt PE=3 SV=1 30 148 1.0E-29
sp|Q48TY5|APT_STRPM Adenine phosphoribosyltransferase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=apt PE=3 SV=1 30 148 1.0E-29
sp|A2REX9|APT_STRPG Adenine phosphoribosyltransferase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=apt PE=3 SV=1 30 148 1.0E-29
sp|Q1J702|APT_STRPF Adenine phosphoribosyltransferase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=apt PE=3 SV=1 30 148 1.0E-29
sp|Q1JH84|APT_STRPD Adenine phosphoribosyltransferase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=apt PE=3 SV=1 30 148 1.0E-29
sp|Q1JM38|APT_STRPC Adenine phosphoribosyltransferase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=apt PE=3 SV=1 30 148 1.0E-29
sp|Q1JC56|APT_STRPB Adenine phosphoribosyltransferase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=apt PE=3 SV=1 30 148 1.0E-29
sp|P63548|APT_STRP8 Adenine phosphoribosyltransferase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=apt PE=3 SV=1 30 148 1.0E-29
sp|Q5XCH4|APT_STRP6 Adenine phosphoribosyltransferase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=apt PE=3 SV=1 30 148 1.0E-29
sp|P0CZ62|APT_STRP3 Adenine phosphoribosyltransferase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=apt PE=3 SV=1 30 148 1.0E-29
sp|P63546|APT_STRP1 Adenine phosphoribosyltransferase OS=Streptococcus pyogenes serotype M1 GN=apt PE=3 SV=1 30 148 1.0E-29
sp|A5EVW7|APT_DICNV Adenine phosphoribosyltransferase OS=Dichelobacter nodosus (strain VCS1703A) GN=apt PE=3 SV=1 28 150 1.0E-29
sp|Q2RWT4|APT_RHORT Adenine phosphoribosyltransferase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=apt PE=3 SV=1 28 138 1.0E-29
sp|Q8DZA4|APT_STRA5 Adenine phosphoribosyltransferase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=apt PE=3 SV=1 30 149 1.0E-29
sp|Q8E4W5|APT_STRA3 Adenine phosphoribosyltransferase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=apt PE=3 SV=1 30 149 1.0E-29
sp|Q24UQ1|APT_DESHY Adenine phosphoribosyltransferase OS=Desulfitobacterium hafniense (strain Y51) GN=apt PE=3 SV=1 9 139 2.0E-29
sp|Q892A7|APT_CLOTE Adenine phosphoribosyltransferase OS=Clostridium tetani (strain Massachusetts / E88) GN=apt PE=3 SV=1 3 140 2.0E-29
sp|B8FQU0|APT_DESHD Adenine phosphoribosyltransferase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=apt PE=3 SV=1 9 139 2.0E-29
sp|Q5N1I0|APT_SYNP6 Adenine phosphoribosyltransferase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=apt PE=3 SV=1 14 141 2.0E-29
sp|Q8YNI3|APT_NOSS1 Adenine phosphoribosyltransferase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=apt PE=3 SV=1 30 149 5.0E-29
sp|A8AWY0|APT_STRGC Adenine phosphoribosyltransferase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=apt PE=3 SV=1 30 148 5.0E-29
sp|Q3MAA1|APT_ANAVT Adenine phosphoribosyltransferase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=apt PE=3 SV=1 30 149 5.0E-29
sp|A8F7S9|APT_PSELT Adenine phosphoribosyltransferase OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=apt PE=3 SV=1 2 141 8.0E-29
sp|Q183I0|APT_PEPD6 Adenine phosphoribosyltransferase OS=Peptoclostridium difficile (strain 630) GN=apt PE=3 SV=1 3 141 9.0E-29
sp|Q04F01|APT_OENOB Adenine phosphoribosyltransferase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=apt PE=3 SV=1 2 144 1.0E-28
sp|B2IU50|APT_NOSP7 Adenine phosphoribosyltransferase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=apt PE=3 SV=1 29 149 1.0E-28
sp|B1HV83|APT_LYSSC Adenine phosphoribosyltransferase OS=Lysinibacillus sphaericus (strain C3-41) GN=apt PE=3 SV=1 30 148 2.0E-28
sp|A9AYX1|APT_HERA2 Adenine phosphoribosyltransferase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=apt PE=3 SV=1 2 141 2.0E-28
sp|Q834G6|APT_ENTFA Adenine phosphoribosyltransferase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=apt PE=3 SV=1 30 149 2.0E-28
sp|P47957|APT_MUSSI Adenine phosphoribosyltransferase OS=Mus spicilegus GN=Aprt PE=3 SV=1 30 140 2.0E-28
sp|P08030|APT_MOUSE Adenine phosphoribosyltransferase OS=Mus musculus GN=Aprt PE=1 SV=2 30 140 2.0E-28
sp|A4IW38|APT_FRATW Adenine phosphoribosyltransferase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=apt PE=3 SV=1 29 148 3.0E-28
sp|Q6D800|APT_PECAS Adenine phosphoribosyltransferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=apt PE=3 SV=1 9 141 3.0E-28
sp|B2V345|APT_CLOBA Adenine phosphoribosyltransferase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=apt PE=3 SV=1 30 141 3.0E-28
sp|Q0HHZ1|APT_SHESM Adenine phosphoribosyltransferase OS=Shewanella sp. (strain MR-4) GN=apt PE=3 SV=1 3 139 3.0E-28
sp|A0KY07|APT_SHESA Adenine phosphoribosyltransferase OS=Shewanella sp. (strain ANA-3) GN=apt PE=3 SV=1 3 139 3.0E-28
sp|B2TMZ9|APT_CLOBB Adenine phosphoribosyltransferase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=apt PE=3 SV=1 30 141 4.0E-28
sp|C6DB82|APT_PECCP Adenine phosphoribosyltransferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=apt PE=3 SV=1 9 139 4.0E-28
sp|Q8RAL9|APT_CALS4 Adenine phosphoribosyltransferase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=apt PE=3 SV=1 30 139 5.0E-28
sp|P47956|APT_MUSPA Adenine phosphoribosyltransferase OS=Mus pahari GN=Aprt PE=3 SV=1 30 140 6.0E-28
sp|A4IRA1|APT_GEOTN Adenine phosphoribosyltransferase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=apt PE=3 SV=1 30 139 6.0E-28
sp|A9WCV7|APT_CHLAA Adenine phosphoribosyltransferase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=apt PE=3 SV=1 3 141 6.0E-28
sp|Q5NII9|APT_FRATT Adenine phosphoribosyltransferase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=apt PE=3 SV=1 29 148 6.0E-28
sp|A0Q8C6|APT_FRATN Adenine phosphoribosyltransferase OS=Francisella tularensis subsp. novicida (strain U112) GN=apt PE=3 SV=1 29 148 6.0E-28
sp|B2SEZ5|APT_FRATM Adenine phosphoribosyltransferase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=apt PE=3 SV=1 29 148 6.0E-28
sp|Q14JZ2|APT_FRAT1 Adenine phosphoribosyltransferase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=apt PE=3 SV=1 29 148 6.0E-28
sp|A9NGG3|APT_ACHLI Adenine phosphoribosyltransferase OS=Acholeplasma laidlawii (strain PG-8A) GN=apt PE=3 SV=1 30 146 7.0E-28
sp|P36972|APT_RAT Adenine phosphoribosyltransferase OS=Rattus norvegicus GN=Aprt PE=1 SV=1 30 140 8.0E-28
sp|Q38W53|APT_LACSS Adenine phosphoribosyltransferase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=apt PE=3 SV=1 2 141 8.0E-28
sp|A1RIP7|APT_SHESW Adenine phosphoribosyltransferase OS=Shewanella sp. (strain W3-18-1) GN=apt PE=3 SV=1 3 139 8.0E-28
sp|A4Y7U1|APT_SHEPC Adenine phosphoribosyltransferase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=apt PE=3 SV=1 3 139 8.0E-28
sp|P36973|APT2_YEAST Adenine phosphoribosyltransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APT2 PE=1 SV=2 30 147 1.0E-27
sp|Q0HU91|APT_SHESR Adenine phosphoribosyltransferase OS=Shewanella sp. (strain MR-7) GN=apt PE=3 SV=1 3 139 1.0E-27
sp|B0K969|APT_THEP3 Adenine phosphoribosyltransferase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=apt PE=1 SV=1 30 139 1.0E-27
sp|Q0SRP2|APT_CLOPS Adenine phosphoribosyltransferase OS=Clostridium perfringens (strain SM101 / Type A) GN=apt PE=3 SV=1 30 149 1.0E-27
sp|Q8XJ22|APT_CLOPE Adenine phosphoribosyltransferase OS=Clostridium perfringens (strain 13 / Type A) GN=apt PE=3 SV=1 30 149 1.0E-27
sp|Q0TP22|APT_CLOP1 Adenine phosphoribosyltransferase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=apt PE=3 SV=1 30 149 1.0E-27
sp|C0QVL4|APT_BRAHW Adenine phosphoribosyltransferase OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=apt PE=3 SV=1 3 149 1.0E-27
sp|A0PZW4|APT_CLONN Adenine phosphoribosyltransferase OS=Clostridium novyi (strain NT) GN=apt PE=3 SV=1 3 141 1.0E-27
sp|B0K0N0|APT_THEPX Adenine phosphoribosyltransferase OS=Thermoanaerobacter sp. (strain X514) GN=apt PE=3 SV=1 30 139 1.0E-27
sp|B8I3F7|APT_CLOCE Adenine phosphoribosyltransferase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=apt PE=3 SV=1 30 139 2.0E-27
sp|Q88VH0|APT_LACPL Adenine phosphoribosyltransferase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=apt PE=3 SV=1 2 141 2.0E-27
sp|Q0BK98|APT_FRATO Adenine phosphoribosyltransferase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=apt PE=3 SV=1 29 148 2.0E-27
sp|Q2A1J5|APT_FRATH Adenine phosphoribosyltransferase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=apt PE=3 SV=1 29 148 2.0E-27
sp|A7NEG0|APT_FRATF Adenine phosphoribosyltransferase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=apt PE=3 SV=1 29 148 2.0E-27
sp|Q5KWS2|APT_GEOKA Adenine phosphoribosyltransferase OS=Geobacillus kaustophilus (strain HTA426) GN=apt PE=3 SV=1 30 139 2.0E-27
sp|C6BSW0|APT_DESAD Adenine phosphoribosyltransferase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=apt PE=3 SV=1 2 148 2.0E-27
sp|A9KIA0|APT_CLOPH Adenine phosphoribosyltransferase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=apt PE=3 SV=1 14 139 2.0E-27
sp|A9L5S5|APT_SHEB9 Adenine phosphoribosyltransferase OS=Shewanella baltica (strain OS195) GN=apt PE=3 SV=1 3 139 2.0E-27
sp|A6WPL2|APT_SHEB8 Adenine phosphoribosyltransferase OS=Shewanella baltica (strain OS185) GN=apt PE=3 SV=1 3 139 2.0E-27
sp|A3D5Q5|APT_SHEB5 Adenine phosphoribosyltransferase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=apt PE=3 SV=1 3 139 2.0E-27
sp|B8E700|APT_SHEB2 Adenine phosphoribosyltransferase OS=Shewanella baltica (strain OS223) GN=apt PE=3 SV=1 3 139 2.0E-27
sp|Q8EFG1|APT_SHEON Adenine phosphoribosyltransferase OS=Shewanella oneidensis (strain MR-1) GN=apt PE=3 SV=2 3 139 3.0E-27
sp|Q4L6Y0|APT_STAHJ Adenine phosphoribosyltransferase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=apt PE=3 SV=1 30 148 3.0E-27
sp|A8MGN2|APT_ALKOO Adenine phosphoribosyltransferase OS=Alkaliphilus oremlandii (strain OhILAs) GN=apt PE=3 SV=1 3 139 3.0E-27
sp|Q49Y73|APT_STAS1 Adenine phosphoribosyltransferase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=apt PE=3 SV=1 30 148 3.0E-27
sp|C5D514|APT_GEOSW Adenine phosphoribosyltransferase OS=Geobacillus sp. (strain WCH70) GN=apt PE=3 SV=1 30 139 3.0E-27
sp|A3QF54|APT_SHELP Adenine phosphoribosyltransferase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=apt PE=3 SV=2 32 141 3.0E-27
sp|P47952|APT_CRIGR Adenine phosphoribosyltransferase OS=Cricetulus griseus GN=APRT PE=3 SV=2 30 149 4.0E-27
sp|Q1D1H1|APT_MYXXD Adenine phosphoribosyltransferase OS=Myxococcus xanthus (strain DK 1622) GN=apt PE=3 SV=1 2 148 4.0E-27
sp|A6WCH4|APT_KINRD Adenine phosphoribosyltransferase OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=apt PE=3 SV=1 1 141 4.0E-27
sp|Q6KI92|APT_MYCMO Adenine phosphoribosyltransferase OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=apt PE=3 SV=1 2 140 5.0E-27
sp|P68781|APT_STAAW Adenine phosphoribosyltransferase OS=Staphylococcus aureus (strain MW2) GN=apt PE=3 SV=1 30 148 5.0E-27
sp|P68780|APT_STAAU Adenine phosphoribosyltransferase OS=Staphylococcus aureus GN=apt PE=3 SV=1 30 148 5.0E-27
sp|A8Z2G2|APT_STAAT Adenine phosphoribosyltransferase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=apt PE=3 SV=1 30 148 5.0E-27
sp|Q6G8T4|APT_STAAS Adenine phosphoribosyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=apt PE=3 SV=1 30 148 5.0E-27
sp|Q6GG69|APT_STAAR Adenine phosphoribosyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=apt PE=3 SV=1 30 148 5.0E-27
sp|P68779|APT_STAAN Adenine phosphoribosyltransferase OS=Staphylococcus aureus (strain N315) GN=apt PE=1 SV=1 30 148 5.0E-27
sp|P68778|APT_STAAM Adenine phosphoribosyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=apt PE=3 SV=1 30 148 5.0E-27
sp|A6QHH7|APT_STAAE Adenine phosphoribosyltransferase OS=Staphylococcus aureus (strain Newman) GN=apt PE=3 SV=1 30 148 5.0E-27
sp|Q5HFC8|APT_STAAC Adenine phosphoribosyltransferase OS=Staphylococcus aureus (strain COL) GN=apt PE=3 SV=1 30 148 5.0E-27
sp|Q2YT95|APT_STAAB Adenine phosphoribosyltransferase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=apt PE=3 SV=1 30 148 5.0E-27
sp|A5ITF9|APT_STAA9 Adenine phosphoribosyltransferase OS=Staphylococcus aureus (strain JH9) GN=apt PE=3 SV=1 30 148 5.0E-27
sp|Q2FXU0|APT_STAA8 Adenine phosphoribosyltransferase OS=Staphylococcus aureus (strain NCTC 8325) GN=apt PE=3 SV=1 30 148 5.0E-27
sp|Q2FG92|APT_STAA3 Adenine phosphoribosyltransferase OS=Staphylococcus aureus (strain USA300) GN=apt PE=3 SV=1 30 148 5.0E-27
sp|A6U2A3|APT_STAA2 Adenine phosphoribosyltransferase OS=Staphylococcus aureus (strain JH1) GN=apt PE=3 SV=1 30 148 5.0E-27
sp|A7X350|APT_STAA1 Adenine phosphoribosyltransferase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=apt PE=3 SV=1 30 148 5.0E-27
sp|O31060|APT_BUTFI Adenine phosphoribosyltransferase OS=Butyrivibrio fibrisolvens GN=apt PE=3 SV=1 30 139 5.0E-27
sp|Q3AAI8|APT_CARHZ Adenine phosphoribosyltransferase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=apt PE=3 SV=1 29 148 6.0E-27
sp|P47958|APT_STOLO Adenine phosphoribosyltransferase OS=Stochomys longicaudatus GN=APRT PE=3 SV=1 30 140 7.0E-27
sp|A8ZWU1|APT_DESOH Adenine phosphoribosyltransferase OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=apt PE=3 SV=1 30 149 7.0E-27
sp|Q0IAT7|APT_SYNS3 Adenine phosphoribosyltransferase OS=Synechococcus sp. (strain CC9311) GN=apt PE=3 SV=1 2 148 7.0E-27
sp|A8GAU8|APT_SERP5 Adenine phosphoribosyltransferase OS=Serratia proteamaculans (strain 568) GN=apt PE=3 SV=1 9 140 8.0E-27
sp|B0TWU0|APT_FRAP2 Adenine phosphoribosyltransferase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=apt PE=3 SV=1 2 139 8.0E-27
sp|Q8CS95|APT_STAES Adenine phosphoribosyltransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=apt PE=3 SV=1 30 148 9.0E-27
sp|Q5HNR6|APT_STAEQ Adenine phosphoribosyltransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=apt PE=3 SV=1 30 148 9.0E-27
sp|Q64427|APT_MASHI Adenine phosphoribosyltransferase OS=Mastomys hildebrandtii GN=APRT PE=3 SV=1 30 140 1.0E-26
sp|Q6A8K3|APT_PROAC Adenine phosphoribosyltransferase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=apt PE=3 SV=1 2 139 1.0E-26
sp|C4ZF43|APT_EUBR3 Adenine phosphoribosyltransferase OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=apt PE=3 SV=1 16 140 1.0E-26
sp|Q5WHQ1|APT_BACSK Adenine phosphoribosyltransferase OS=Bacillus clausii (strain KSM-K16) GN=apt PE=3 SV=1 30 139 1.0E-26
sp|Q98QN9|APT_MYCPU Adenine phosphoribosyltransferase OS=Mycoplasma pulmonis (strain UAB CTIP) GN=apt PE=3 SV=1 30 140 2.0E-26
sp|Q56JW4|APT_BOVIN Adenine phosphoribosyltransferase OS=Bos taurus GN=APRT PE=2 SV=1 30 140 2.0E-26
sp|Q64414|APT_DIPCP Adenine phosphoribosyltransferase OS=Dipodillus campestris GN=APRT PE=3 SV=1 30 140 2.0E-26
sp|A7GHS8|APT_CLOBL Adenine phosphoribosyltransferase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=apt PE=3 SV=1 14 139 2.0E-26
sp|B1IME3|APT_CLOBK Adenine phosphoribosyltransferase OS=Clostridium botulinum (strain Okra / Type B1) GN=apt PE=3 SV=1 14 139 2.0E-26
sp|A5I6E1|APT_CLOBH Adenine phosphoribosyltransferase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=apt PE=3 SV=1 14 139 2.0E-26
sp|A7FY09|APT_CLOB1 Adenine phosphoribosyltransferase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=apt PE=3 SV=1 14 139 2.0E-26
sp|Q2W3C2|APT_MAGSA Adenine phosphoribosyltransferase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=apt PE=3 SV=1 29 141 2.0E-26
sp|Q0S1C1|APT_RHOJR Adenine phosphoribosyltransferase OS=Rhodococcus jostii (strain RHA1) GN=apt PE=3 SV=1 1 140 2.0E-26
sp|A8ESP0|APT_ARCB4 Adenine phosphoribosyltransferase OS=Arcobacter butzleri (strain RM4018) GN=apt PE=3 SV=1 3 141 2.0E-26
sp|A5GLQ5|APT_SYNPW Adenine phosphoribosyltransferase OS=Synechococcus sp. (strain WH7803) GN=apt PE=3 SV=1 29 139 3.0E-26
sp|Q67LM3|APT_SYMTH Adenine phosphoribosyltransferase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=apt PE=3 SV=1 8 139 3.0E-26
sp|B8CXF1|APT_HALOH Adenine phosphoribosyltransferase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=apt PE=3 SV=1 30 139 3.0E-26
sp|O87330|APT_CORGL Adenine phosphoribosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=apt PE=3 SV=1 1 149 3.0E-26
sp|A0AIX3|APT_LISW6 Adenine phosphoribosyltransferase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=apt PE=3 SV=1 30 148 3.0E-26
sp|B8DHM4|APT_LISMH Adenine phosphoribosyltransferase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=apt PE=3 SV=1 30 148 3.0E-26
sp|Q71ZE6|APT_LISMF Adenine phosphoribosyltransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=apt PE=3 SV=1 30 148 3.0E-26
sp|C1KVH1|APT_LISMC Adenine phosphoribosyltransferase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=apt PE=3 SV=1 30 148 3.0E-26
sp|P0A2X5|APT_LISMO Adenine phosphoribosyltransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=apt PE=3 SV=1 30 148 3.0E-26
sp|P0A2X6|APT_LISIN Adenine phosphoribosyltransferase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=apt PE=3 SV=1 30 148 3.0E-26
sp|B1L0A2|APT_CLOBM Adenine phosphoribosyltransferase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=apt PE=3 SV=1 14 139 3.0E-26
sp|Q43199|APT1_WHEAT Adenine phosphoribosyltransferase 1 OS=Triticum aestivum GN=APT1 PE=2 SV=1 31 148 4.0E-26
sp|Q03F39|APT_PEDPA Adenine phosphoribosyltransferase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=apt PE=3 SV=1 30 149 4.0E-26
sp|A4J2G8|APT_DESRM Adenine phosphoribosyltransferase OS=Desulfotomaculum reducens (strain MI-1) GN=apt PE=3 SV=1 30 148 4.0E-26
sp|A5N1Z4|APT_CLOK5 Adenine phosphoribosyltransferase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=apt PE=3 SV=1 30 139 4.0E-26
sp|B9E5P8|APT_CLOK1 Adenine phosphoribosyltransferase OS=Clostridium kluyveri (strain NBRC 12016) GN=apt PE=3 SV=1 30 139 4.0E-26
sp|C0ZAP9|APT_BREBN Adenine phosphoribosyltransferase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=apt PE=3 SV=1 30 141 5.0E-26
sp|C1B4D6|APT_RHOOB Adenine phosphoribosyltransferase OS=Rhodococcus opacus (strain B4) GN=apt PE=3 SV=1 1 140 5.0E-26
sp|A7Z756|APT_BACMF Adenine phosphoribosyltransferase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=apt PE=3 SV=1 30 148 5.0E-26
sp|A4FYD7|APT_METM5 Adenine phosphoribosyltransferase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=apt1 PE=3 SV=1 30 139 5.0E-26
sp|A4XI79|APT_CALS8 Adenine phosphoribosyltransferase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=apt PE=3 SV=1 30 139 5.0E-26
sp|Q5LIY6|APT_BACFN Adenine phosphoribosyltransferase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=apt PE=3 SV=1 32 137 6.0E-26
sp|A4QEM8|APT_CORGB Adenine phosphoribosyltransferase OS=Corynebacterium glutamicum (strain R) GN=apt PE=3 SV=1 1 150 7.0E-26
sp|Q7N0N9|APT_PHOLL Adenine phosphoribosyltransferase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=apt PE=3 SV=1 9 139 7.0E-26
sp|O34443|APT_BACSU Adenine phosphoribosyltransferase OS=Bacillus subtilis (strain 168) GN=apt PE=3 SV=1 30 148 7.0E-26
sp|A1JNC2|APT_YERE8 Adenine phosphoribosyltransferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=apt PE=3 SV=1 9 141 7.0E-26
sp|Q6LZG8|APT_METMP Adenine phosphoribosyltransferase OS=Methanococcus maripaludis (strain S2 / LL) GN=apt2 PE=3 SV=1 30 139 7.0E-26
sp|B7IEY2|APT_THEAB Adenine phosphoribosyltransferase OS=Thermosipho africanus (strain TCF52B) GN=apt PE=3 SV=1 2 148 8.0E-26
sp|C5CIH1|APT_KOSOT Adenine phosphoribosyltransferase OS=Kosmotoga olearia (strain TBF 19.5.1) GN=apt PE=3 SV=1 2 140 8.0E-26
sp|P07741|APT_HUMAN Adenine phosphoribosyltransferase OS=Homo sapiens GN=APRT PE=1 SV=2 30 139 8.0E-26
sp|C3LTV0|APT_VIBCM Adenine phosphoribosyltransferase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=apt PE=3 SV=1 32 139 9.0E-26
sp|Q9KT52|APT_VIBCH Adenine phosphoribosyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=apt PE=3 SV=1 32 139 9.0E-26
sp|A5F2N2|APT_VIBC3 Adenine phosphoribosyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=apt PE=3 SV=1 32 139 9.0E-26
sp|A8FFQ0|APT_BACP2 Adenine phosphoribosyltransferase OS=Bacillus pumilus (strain SAFR-032) GN=apt PE=3 SV=1 30 139 9.0E-26
sp|A7GT90|APT_BACCN Adenine phosphoribosyltransferase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=apt PE=3 SV=1 30 139 9.0E-26
sp|A6LTN5|APT_CLOB8 Adenine phosphoribosyltransferase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=apt PE=3 SV=1 30 139 9.0E-26
sp|B1KNJ9|APT_SHEWM Adenine phosphoribosyltransferase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=apt PE=3 SV=1 32 141 1.0E-25
sp|Q1GTG6|APT_SPHAL Adenine phosphoribosyltransferase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=apt PE=3 SV=1 29 142 1.0E-25
sp|A7MUE7|APT_VIBCB Adenine phosphoribosyltransferase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=apt PE=3 SV=1 32 139 1.0E-25
sp|A6TQN8|APT_ALKMQ Adenine phosphoribosyltransferase OS=Alkaliphilus metalliredigens (strain QYMF) GN=apt PE=3 SV=1 30 139 1.0E-25
sp|B9E711|APT_MACCJ Adenine phosphoribosyltransferase OS=Macrococcus caseolyticus (strain JCSC5402) GN=apt PE=3 SV=1 3 139 1.0E-25
sp|Q87MQ1|APT_VIBPA Adenine phosphoribosyltransferase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=apt PE=3 SV=1 32 139 1.0E-25
sp|Q8RDM9|APT_FUSNN Adenine phosphoribosyltransferase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=apt PE=3 SV=1 30 148 1.0E-25
sp|Q1WT53|APT_LACS1 Adenine phosphoribosyltransferase OS=Lactobacillus salivarius (strain UCC118) GN=apt PE=3 SV=1 30 148 1.0E-25
sp|Q3J5E9|APT_RHOS4 Adenine phosphoribosyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=apt PE=3 SV=1 30 139 1.0E-25
sp|A6USF2|APT_METVS Adenine phosphoribosyltransferase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=apt2 PE=3 SV=1 30 139 1.0E-25
sp|Q66DQ2|APT_YERPS Adenine phosphoribosyltransferase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=apt PE=1 SV=1 32 139 2.0E-25
sp|A6VJW6|APT_METM7 Adenine phosphoribosyltransferase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=apt2 PE=3 SV=1 30 139 2.0E-25
sp|Q7MIV1|APT_VIBVY Adenine phosphoribosyltransferase OS=Vibrio vulnificus (strain YJ016) GN=apt PE=3 SV=1 32 139 2.0E-25
sp|Q8DB25|APT_VIBVU Adenine phosphoribosyltransferase OS=Vibrio vulnificus (strain CMCP6) GN=apt PE=3 SV=1 32 139 2.0E-25
sp|C4L8U7|APT_TOLAT Adenine phosphoribosyltransferase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=apt PE=3 SV=1 30 139 2.0E-25
sp|B1JHN6|APT_YERPY Adenine phosphoribosyltransferase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=apt PE=3 SV=1 32 139 2.0E-25
sp|A4TPB0|APT_YERPP Adenine phosphoribosyltransferase OS=Yersinia pestis (strain Pestoides F) GN=apt PE=3 SV=1 32 139 2.0E-25
sp|Q1CL33|APT_YERPN Adenine phosphoribosyltransferase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=apt PE=3 SV=1 32 139 2.0E-25
sp|A9R0Q1|APT_YERPG Adenine phosphoribosyltransferase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=apt PE=3 SV=1 32 139 2.0E-25
sp|Q8ZC94|APT_YERPE Adenine phosphoribosyltransferase OS=Yersinia pestis GN=apt PE=3 SV=1 32 139 2.0E-25
sp|B2K6Z1|APT_YERPB Adenine phosphoribosyltransferase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=apt PE=3 SV=1 32 139 2.0E-25
sp|Q1C4P3|APT_YERPA Adenine phosphoribosyltransferase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=apt PE=3 SV=1 32 139 2.0E-25
sp|A7FL92|APT_YERP3 Adenine phosphoribosyltransferase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=apt PE=3 SV=1 32 139 2.0E-25
sp|Q634D6|APT_BACCZ Adenine phosphoribosyltransferase OS=Bacillus cereus (strain ZK / E33L) GN=apt PE=3 SV=1 2 139 2.0E-25
sp|Q817X3|APT_BACCR Adenine phosphoribosyltransferase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=apt PE=3 SV=1 2 139 2.0E-25
sp|B7HE42|APT_BACC4 Adenine phosphoribosyltransferase OS=Bacillus cereus (strain B4264) GN=apt PE=3 SV=1 2 139 2.0E-25
sp|B7IIS0|APT_BACC2 Adenine phosphoribosyltransferase OS=Bacillus cereus (strain G9842) GN=apt PE=3 SV=1 2 139 2.0E-25
sp|Q5E463|APT_VIBF1 Adenine phosphoribosyltransferase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=apt PE=3 SV=1 32 139 2.0E-25
sp|B7VL95|APT_VIBTL Adenine phosphoribosyltransferase OS=Vibrio tasmaniensis (strain LGP32) GN=apt PE=3 SV=1 32 139 2.0E-25
sp|Q650H6|APT_BACFR Adenine phosphoribosyltransferase OS=Bacteroides fragilis (strain YCH46) GN=apt PE=3 SV=1 32 137 2.0E-25
sp|A1S560|APT_SHEAM Adenine phosphoribosyltransferase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=apt PE=3 SV=1 32 139 2.0E-25
sp|Q8KKS1|APT2_RHIEC Adenine phosphoribosyltransferase 2 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=apt2 PE=3 SV=2 30 142 2.0E-25
sp|A2C9I6|APT_PROM3 Adenine phosphoribosyltransferase OS=Prochlorococcus marinus (strain MIT 9303) GN=apt PE=3 SV=2 29 139 3.0E-25
sp|A8H2P5|APT_SHEPA Adenine phosphoribosyltransferase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=apt PE=3 SV=1 32 139 3.0E-25
sp|B6EJ41|APT_ALISL Adenine phosphoribosyltransferase OS=Aliivibrio salmonicida (strain LFI1238) GN=apt PE=3 SV=1 32 139 3.0E-25
sp|B0TNZ8|APT_SHEHH Adenine phosphoribosyltransferase OS=Shewanella halifaxensis (strain HAW-EB4) GN=apt PE=3 SV=1 32 139 3.0E-25
sp|Q038P1|APT_LACC3 Adenine phosphoribosyltransferase OS=Lactobacillus casei (strain ATCC 334) GN=apt PE=3 SV=1 2 148 3.0E-25
sp|A9VIN4|APT_BACWK Adenine phosphoribosyltransferase OS=Bacillus weihenstephanensis (strain KBAB4) GN=apt PE=3 SV=1 2 139 3.0E-25
sp|A5URA4|APT_ROSS1 Adenine phosphoribosyltransferase OS=Roseiflexus sp. (strain RS-1) GN=apt PE=3 SV=1 2 140 3.0E-25
sp|A1SX04|APT_PSYIN Adenine phosphoribosyltransferase OS=Psychromonas ingrahamii (strain 37) GN=apt PE=3 SV=1 3 139 4.0E-25
sp|Q049X1|APT_LACDB Adenine phosphoribosyltransferase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=apt PE=3 SV=1 30 141 4.0E-25
sp|Q1G9R7|APT_LACDA Adenine phosphoribosyltransferase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=apt PE=3 SV=2 30 141 4.0E-25
sp|Q39VR8|APT_GEOMG Adenine phosphoribosyltransferase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=apt PE=3 SV=1 3 148 5.0E-25
sp|Q6HDB8|APT_BACHK Adenine phosphoribosyltransferase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=apt PE=3 SV=1 2 139 5.0E-25
sp|B9IYY2|APT_BACCQ Adenine phosphoribosyltransferase OS=Bacillus cereus (strain Q1) GN=apt PE=3 SV=1 2 139 5.0E-25
sp|B7HQG7|APT_BACC7 Adenine phosphoribosyltransferase OS=Bacillus cereus (strain AH187) GN=apt PE=3 SV=1 2 139 5.0E-25
sp|Q730C4|APT_BACC1 Adenine phosphoribosyltransferase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=apt PE=3 SV=1 2 139 5.0E-25
sp|B7JPZ4|APT_BACC0 Adenine phosphoribosyltransferase OS=Bacillus cereus (strain AH820) GN=apt PE=3 SV=1 2 139 5.0E-25
sp|Q81LI1|APT_BACAN Adenine phosphoribosyltransferase OS=Bacillus anthracis GN=apt PE=3 SV=1 2 139 5.0E-25
sp|A0RJ16|APT_BACAH Adenine phosphoribosyltransferase OS=Bacillus thuringiensis (strain Al Hakam) GN=apt PE=3 SV=1 2 139 5.0E-25
sp|C3L613|APT_BACAC Adenine phosphoribosyltransferase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=apt PE=3 SV=1 2 139 5.0E-25
sp|C3P995|APT_BACAA Adenine phosphoribosyltransferase OS=Bacillus anthracis (strain A0248) GN=apt PE=3 SV=1 2 139 5.0E-25
sp|A5FVJ4|APT_ACICJ Adenine phosphoribosyltransferase OS=Acidiphilium cryptum (strain JF-5) GN=apt PE=3 SV=1 29 139 5.0E-25
sp|B9M4Z1|APT_GEODF Adenine phosphoribosyltransferase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=apt PE=3 SV=1 3 139 5.0E-25
sp|B3DXQ2|APT_METI4 Adenine phosphoribosyltransferase OS=Methylacidiphilum infernorum (isolate V4) GN=apt PE=3 SV=1 30 139 5.0E-25
sp|Q11TJ3|APT_CYTH3 Adenine phosphoribosyltransferase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=apt PE=3 SV=1 13 146 5.0E-25
sp|B5Z3X9|APT_ECO5E Adenine phosphoribosyltransferase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=apt PE=3 SV=1 3 139 6.0E-25
sp|Q8XD48|APT_ECO57 Adenine phosphoribosyltransferase OS=Escherichia coli O157:H7 GN=apt PE=3 SV=1 3 139 6.0E-25
sp|A9BG28|APT_PETMO Adenine phosphoribosyltransferase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=apt PE=3 SV=1 2 148 7.0E-25
sp|B9KM05|APT_RHOSK Adenine phosphoribosyltransferase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=apt PE=3 SV=1 30 139 7.0E-25
sp|P31166|APT1_ARATH Adenine phosphoribosyltransferase 1, chloroplastic OS=Arabidopsis thaliana GN=APT1 PE=1 SV=2 30 151 7.0E-25
sp|A7H8F4|APT_ANADF Adenine phosphoribosyltransferase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=apt PE=3 SV=1 2 149 7.0E-25
sp|Q65GQ8|APT_BACLD Adenine phosphoribosyltransferase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=apt PE=3 SV=1 30 139 7.0E-25
sp|B1LBU1|APT_THESQ Adenine phosphoribosyltransferase OS=Thermotoga sp. (strain RQ2) GN=apt PE=3 SV=1 30 147 8.0E-25
sp|B9DNG3|APT_STACT Adenine phosphoribosyltransferase OS=Staphylococcus carnosus (strain TM300) GN=apt PE=3 SV=1 30 139 8.0E-25
sp|B3E683|APT_GEOLS Adenine phosphoribosyltransferase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=apt PE=3 SV=1 30 148 8.0E-25
sp|B7LLQ1|APT_ESCF3 Adenine phosphoribosyltransferase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=apt PE=3 SV=1 3 139 8.0E-25
sp|Q9X1A4|APT_THEMA Adenine phosphoribosyltransferase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=apt PE=3 SV=1 30 147 9.0E-25
sp|A4WQ67|APT_RHOS5 Adenine phosphoribosyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=apt PE=3 SV=1 30 139 1.0E-24
sp|A5IMI9|APT_THEP1 Adenine phosphoribosyltransferase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=apt PE=3 SV=1 30 147 1.0E-24
sp|B9K8V0|APT_THENN Adenine phosphoribosyltransferase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=apt PE=3 SV=1 30 147 1.0E-24
sp|Q8UD91|APT_AGRFC Adenine phosphoribosyltransferase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=apt PE=3 SV=2 30 141 1.0E-24
sp|Q83M42|APT_SHIFL Adenine phosphoribosyltransferase OS=Shigella flexneri GN=apt PE=3 SV=2 3 139 1.0E-24
sp|Q0T7B5|APT_SHIF8 Adenine phosphoribosyltransferase OS=Shigella flexneri serotype 5b (strain 8401) GN=apt PE=3 SV=1 3 139 1.0E-24
sp|Q3JEP4|APT_NITOC Adenine phosphoribosyltransferase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=apt PE=3 SV=2 8 141 1.0E-24
sp|P52561|APT_STRCO Adenine phosphoribosyltransferase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=apt PE=3 SV=1 2 139 1.0E-24
sp|B8CMY5|APT_SHEPW Adenine phosphoribosyltransferase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=apt PE=3 SV=1 32 139 1.0E-24
sp|Q8PJY6|APT_XANAC Adenine phosphoribosyltransferase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=apt PE=3 SV=1 2 141 1.0E-24
sp|Q3Z4T0|APT_SHISS Adenine phosphoribosyltransferase OS=Shigella sonnei (strain Ss046) GN=apt PE=3 SV=1 3 139 1.0E-24
sp|Q32J49|APT_SHIDS Adenine phosphoribosyltransferase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=apt PE=3 SV=1 3 139 1.0E-24
sp|Q325C7|APT_SHIBS Adenine phosphoribosyltransferase OS=Shigella boydii serotype 4 (strain Sb227) GN=apt PE=3 SV=1 3 139 1.0E-24
sp|B2U4S2|APT_SHIB3 Adenine phosphoribosyltransferase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=apt PE=3 SV=1 3 139 1.0E-24
sp|Q1RF67|APT_ECOUT Adenine phosphoribosyltransferase OS=Escherichia coli (strain UTI89 / UPEC) GN=apt PE=3 SV=2 3 139 1.0E-24
sp|B1LJM6|APT_ECOSM Adenine phosphoribosyltransferase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=apt PE=3 SV=1 3 139 1.0E-24
sp|B6I0C1|APT_ECOSE Adenine phosphoribosyltransferase OS=Escherichia coli (strain SE11) GN=apt PE=3 SV=1 3 139 1.0E-24
sp|B7N922|APT_ECOLU Adenine phosphoribosyltransferase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=apt PE=3 SV=1 3 139 1.0E-24
sp|P69503|APT_ECOLI Adenine phosphoribosyltransferase OS=Escherichia coli (strain K12) GN=apt PE=1 SV=1 3 139 1.0E-24
sp|B1IZC5|APT_ECOLC Adenine phosphoribosyltransferase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=apt PE=3 SV=1 3 139 1.0E-24
sp|P69504|APT_ECOL6 Adenine phosphoribosyltransferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=apt PE=3 SV=1 3 139 1.0E-24
sp|Q0TKH2|APT_ECOL5 Adenine phosphoribosyltransferase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=apt PE=3 SV=1 3 139 1.0E-24
sp|A1A8D5|APT_ECOK1 Adenine phosphoribosyltransferase OS=Escherichia coli O1:K1 / APEC GN=apt PE=3 SV=2 3 139 1.0E-24
sp|A7ZXC7|APT_ECOHS Adenine phosphoribosyltransferase OS=Escherichia coli O9:H4 (strain HS) GN=apt PE=3 SV=1 3 139 1.0E-24
sp|B1XFQ6|APT_ECODH Adenine phosphoribosyltransferase OS=Escherichia coli (strain K12 / DH10B) GN=apt PE=3 SV=1 3 139 1.0E-24
sp|C4ZUS3|APT_ECOBW Adenine phosphoribosyltransferase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=apt PE=3 SV=1 3 139 1.0E-24
sp|B7M3W1|APT_ECO8A Adenine phosphoribosyltransferase OS=Escherichia coli O8 (strain IAI1) GN=apt PE=3 SV=1 3 139 1.0E-24
sp|B7MQI4|APT_ECO81 Adenine phosphoribosyltransferase OS=Escherichia coli O81 (strain ED1a) GN=apt PE=3 SV=1 3 139 1.0E-24
sp|B7NIG1|APT_ECO7I Adenine phosphoribosyltransferase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=apt PE=3 SV=1 3 139 1.0E-24
sp|B7L794|APT_ECO55 Adenine phosphoribosyltransferase OS=Escherichia coli (strain 55989 / EAEC) GN=apt PE=3 SV=1 3 139 1.0E-24
sp|B7MDZ1|APT_ECO45 Adenine phosphoribosyltransferase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=apt PE=3 SV=1 3 139 1.0E-24
sp|B7UKE9|APT_ECO27 Adenine phosphoribosyltransferase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=apt PE=3 SV=1 3 139 1.0E-24
sp|A7ZIM8|APT_ECO24 Adenine phosphoribosyltransferase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=apt PE=3 SV=1 3 139 1.0E-24
sp|Q8Z8T4|APT_SALTI Adenine phosphoribosyltransferase OS=Salmonella typhi GN=apt PE=3 SV=1 3 139 2.0E-24
sp|A5GSL0|APT_SYNR3 Adenine phosphoribosyltransferase OS=Synechococcus sp. (strain RCC307) GN=apt PE=3 SV=1 29 139 2.0E-24
sp|Q9KDH2|APT_BACHD Adenine phosphoribosyltransferase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=apt PE=3 SV=1 30 139 2.0E-24
sp|Q15RT2|APT_PSEA6 Adenine phosphoribosyltransferase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=apt PE=3 SV=1 10 141 2.0E-24
sp|Q8ZRA2|APT_SALTY Adenine phosphoribosyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=apt PE=3 SV=1 3 139 2.0E-24
sp|B4TMG1|APT_SALSV Adenine phosphoribosyltransferase OS=Salmonella schwarzengrund (strain CVM19633) GN=apt PE=3 SV=1 3 139 2.0E-24
sp|B5BD49|APT_SALPK Adenine phosphoribosyltransferase OS=Salmonella paratyphi A (strain AKU_12601) GN=apt PE=3 SV=1 3 139 2.0E-24
sp|C0Q807|APT_SALPC Adenine phosphoribosyltransferase OS=Salmonella paratyphi C (strain RKS4594) GN=apt PE=3 SV=1 3 139 2.0E-24
sp|A9MW92|APT_SALPB Adenine phosphoribosyltransferase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=apt PE=3 SV=1 3 139 2.0E-24
sp|Q5PFK3|APT_SALPA Adenine phosphoribosyltransferase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=apt PE=3 SV=1 3 139 2.0E-24
sp|B4SWX6|APT_SALNS Adenine phosphoribosyltransferase OS=Salmonella newport (strain SL254) GN=apt PE=3 SV=1 3 139 2.0E-24
sp|B5QU72|APT_SALEP Adenine phosphoribosyltransferase OS=Salmonella enteritidis PT4 (strain P125109) GN=apt PE=3 SV=1 3 139 2.0E-24
sp|B5FKY7|APT_SALDC Adenine phosphoribosyltransferase OS=Salmonella dublin (strain CT_02021853) GN=apt PE=3 SV=1 3 139 2.0E-24
sp|Q57S81|APT_SALCH Adenine phosphoribosyltransferase OS=Salmonella choleraesuis (strain SC-B67) GN=apt PE=3 SV=1 3 139 2.0E-24
sp|B5EXM5|APT_SALA4 Adenine phosphoribosyltransferase OS=Salmonella agona (strain SL483) GN=apt PE=3 SV=1 3 139 2.0E-24
sp|Q0AJC5|APT_NITEC Adenine phosphoribosyltransferase OS=Nitrosomonas eutropha (strain C91) GN=apt PE=3 SV=1 14 139 2.0E-24
sp|B5ZY62|APT_RHILW Adenine phosphoribosyltransferase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=apt PE=3 SV=1 30 139 2.0E-24
sp|A5FFL9|APT_FLAJ1 Adenine phosphoribosyltransferase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=apt PE=3 SV=1 30 141 2.0E-24
sp|Q080R2|APT_SHEFN Adenine phosphoribosyltransferase OS=Shewanella frigidimarina (strain NCIMB 400) GN=apt PE=3 SV=1 32 139 2.0E-24
sp|A8FX87|APT_SHESH Adenine phosphoribosyltransferase OS=Shewanella sediminis (strain HAW-EB3) GN=apt PE=3 SV=1 32 139 2.0E-24
sp|A9MLY9|APT_SALAR Adenine phosphoribosyltransferase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=apt PE=3 SV=1 32 139 3.0E-24
sp|Q7V7D8|APT_PROMM Adenine phosphoribosyltransferase OS=Prochlorococcus marinus (strain MIT 9313) GN=apt PE=3 SV=1 29 139 3.0E-24
sp|A7HVC7|APT_PARL1 Adenine phosphoribosyltransferase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=apt PE=3 SV=1 30 139 3.0E-24
sp|Q9SUW2|APT3_ARATH Adenine phosphoribosyltransferase 3 OS=Arabidopsis thaliana GN=APT3 PE=1 SV=1 14 149 3.0E-24
sp|B8ILP3|APT_METNO Adenine phosphoribosyltransferase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=apt PE=3 SV=1 30 139 3.0E-24
sp|Q12LL4|APT_SHEDO Adenine phosphoribosyltransferase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=apt PE=3 SV=1 32 139 3.0E-24
sp|B1YJG1|APT_EXIS2 Adenine phosphoribosyltransferase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=apt PE=3 SV=1 30 139 4.0E-24
sp|A5G4S5|APT_GEOUR Adenine phosphoribosyltransferase OS=Geobacter uraniireducens (strain Rf4) GN=apt PE=3 SV=1 3 148 5.0E-24
sp|Q2K5T4|APT1_RHIEC Adenine phosphoribosyltransferase 1 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=apt1 PE=3 SV=2 30 139 5.0E-24
sp|Q1MDK6|APT_RHIL3 Adenine phosphoribosyltransferase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=apt PE=3 SV=1 30 139 5.0E-24
sp|Q1GE59|APT_RUEST Adenine phosphoribosyltransferase OS=Ruegeria sp. (strain TM1040) GN=apt PE=3 SV=1 30 139 6.0E-24
sp|Q11GC0|APT_CHESB Adenine phosphoribosyltransferase OS=Chelativorans sp. (strain BNC1) GN=apt PE=3 SV=1 30 139 7.0E-24
sp|Q21QM7|APT_RHOFT Adenine phosphoribosyltransferase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=apt PE=3 SV=1 2 139 7.0E-24
sp|B3EMG7|APT_CHLPB Adenine phosphoribosyltransferase OS=Chlorobium phaeobacteroides (strain BS1) GN=apt PE=3 SV=1 30 139 7.0E-24
sp|B9ML31|APT_CALBD Adenine phosphoribosyltransferase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=apt PE=3 SV=1 30 139 7.0E-24
sp|A8YVP7|APT_LACH4 Adenine phosphoribosyltransferase OS=Lactobacillus helveticus (strain DPC 4571) GN=apt PE=3 SV=1 30 141 8.0E-24
sp|Q6LTE9|APT_PHOPR Adenine phosphoribosyltransferase OS=Photobacterium profundum GN=apt PE=3 SV=1 32 139 8.0E-24
sp|Q1AW34|APT_RUBXD Adenine phosphoribosyltransferase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=apt PE=3 SV=1 2 139 8.0E-24
sp|Q5FJP9|APT_LACAC Adenine phosphoribosyltransferase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=apt PE=3 SV=1 30 141 8.0E-24
sp|B4EU76|APT_PROMH Adenine phosphoribosyltransferase OS=Proteus mirabilis (strain HI4320) GN=apt PE=3 SV=1 6 139 8.0E-24
sp|A1WDB0|APT_ACISJ Adenine phosphoribosyltransferase OS=Acidovorax sp. (strain JS42) GN=apt PE=3 SV=1 2 139 9.0E-24
sp|B5R607|APT_SALG2 Adenine phosphoribosyltransferase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=apt PE=3 SV=1 3 139 9.0E-24
sp|A3PGY5|APT_RHOS1 Adenine phosphoribosyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=apt PE=3 SV=1 30 139 9.0E-24
sp|Q9RFQ2|APT_MYCFP Adenine phosphoribosyltransferase OS=Mycoplasma fermentans (strain ATCC 19989 / NBRC 14854 / NCTC 10117 / PG18) GN=apt PE=3 SV=1 30 137 9.0E-24
sp|A4W7F3|APT_ENT38 Adenine phosphoribosyltransferase OS=Enterobacter sp. (strain 638) GN=apt PE=3 SV=1 3 139 1.0E-23
sp|Q98HV0|APT_RHILO Adenine phosphoribosyltransferase OS=Rhizobium loti (strain MAFF303099) GN=apt PE=3 SV=1 30 139 1.0E-23
sp|Q5GZA0|APT_XANOR Adenine phosphoribosyltransferase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=apt PE=3 SV=1 2 141 1.0E-23
sp|Q2P2B0|APT_XANOM Adenine phosphoribosyltransferase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=apt PE=3 SV=1 2 141 1.0E-23
sp|A9HEW1|APT_GLUDA Adenine phosphoribosyltransferase OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=apt PE=3 SV=1 29 139 1.0E-23
sp|B2SHR3|APT_XANOP Adenine phosphoribosyltransferase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=apt PE=3 SV=1 2 141 1.0E-23
sp|A7MJV7|APT_CROS8 Adenine phosphoribosyltransferase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=apt PE=3 SV=1 3 140 1.0E-23
sp|Q01QQ9|APT_SOLUE Adenine phosphoribosyltransferase OS=Solibacter usitatus (strain Ellin6076) GN=apt PE=3 SV=1 30 140 1.0E-23
sp|A4SMN3|APT_AERS4 Adenine phosphoribosyltransferase OS=Aeromonas salmonicida (strain A449) GN=apt PE=3 SV=1 3 139 2.0E-23
sp|A1SJB1|APT_NOCSJ Adenine phosphoribosyltransferase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=apt PE=3 SV=1 27 148 2.0E-23
sp|Q92N62|APT_RHIME Adenine phosphoribosyltransferase OS=Rhizobium meliloti (strain 1021) GN=apt PE=3 SV=1 30 139 2.0E-23
sp|A5IZD7|APT_MYCAP Adenine phosphoribosyltransferase OS=Mycoplasma agalactiae (strain PG2) GN=apt PE=3 SV=1 30 141 2.0E-23
sp|Q119D0|APT_TRIEI Adenine phosphoribosyltransferase OS=Trichodesmium erythraeum (strain IMS101) GN=apt PE=3 SV=1 29 149 2.0E-23
sp|Q3BSE4|APT_XANC5 Adenine phosphoribosyltransferase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=apt PE=3 SV=1 2 141 2.0E-23
sp|B4T9H6|APT_SALHS Adenine phosphoribosyltransferase OS=Salmonella heidelberg (strain SL476) GN=apt PE=3 SV=1 3 139 2.0E-23
sp|Q0BVB8|APT_GRABC Adenine phosphoribosyltransferase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=apt PE=3 SV=1 3 140 3.0E-23
sp|A0KKD3|APT_AERHH Adenine phosphoribosyltransferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=apt PE=3 SV=2 32 139 3.0E-23
sp|Q7TTW1|APT_SYNPX Adenine phosphoribosyltransferase OS=Synechococcus sp. (strain WH8102) GN=apt PE=3 SV=1 23 141 3.0E-23
sp|Q03QP8|APT_LACBA Adenine phosphoribosyltransferase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=apt PE=3 SV=1 30 139 3.0E-23
sp|A8AJX4|APT_CITK8 Adenine phosphoribosyltransferase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=apt PE=3 SV=1 3 139 3.0E-23
sp|B5Y0N8|APT_KLEP3 Adenine phosphoribosyltransferase OS=Klebsiella pneumoniae (strain 342) GN=apt PE=3 SV=1 3 139 4.0E-23
sp|A6T5N2|APT_KLEP7 Adenine phosphoribosyltransferase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=apt PE=3 SV=1 3 139 4.0E-23
sp|Q8EPR5|APT_OCEIH Adenine phosphoribosyltransferase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=apt PE=3 SV=1 2 139 4.0E-23
sp|Q74IU0|APT_LACJO Adenine phosphoribosyltransferase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=apt PE=3 SV=1 30 141 4.0E-23
sp|Q8KLQ0|APT_STRGB Adenine phosphoribosyltransferase OS=Streptomyces galbus GN=apt PE=3 SV=1 2 139 4.0E-23
sp|Q9PQ02|APT_UREPA Adenine phosphoribosyltransferase OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=apt PE=3 SV=1 30 140 4.0E-23
sp|B1AJC8|APT_UREP2 Adenine phosphoribosyltransferase OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=apt PE=3 SV=1 30 140 4.0E-23
sp|B1MZQ2|APT_LEUCK Adenine phosphoribosyltransferase OS=Leuconostoc citreum (strain KM20) GN=apt PE=3 SV=2 2 139 5.0E-23
sp|Q47XQ8|APT_COLP3 Adenine phosphoribosyltransferase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=apt PE=3 SV=1 32 141 5.0E-23
sp|A8LXX3|APT_SALAI Adenine phosphoribosyltransferase OS=Salinispora arenicola (strain CNS-205) GN=apt PE=3 SV=1 1 148 5.0E-23
sp|A7NG77|APT_ROSCS Adenine phosphoribosyltransferase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=apt PE=3 SV=1 2 141 5.0E-23
sp|B0RS13|APT_XANCB Adenine phosphoribosyltransferase OS=Xanthomonas campestris pv. campestris (strain B100) GN=apt PE=3 SV=1 2 138 6.0E-23
sp|C4XU70|APT_DESMR Adenine phosphoribosyltransferase OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=apt PE=3 SV=1 32 139 6.0E-23
sp|Q8P8F9|APT_XANCP Adenine phosphoribosyltransferase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=apt PE=3 SV=1 2 138 6.0E-23
sp|Q4UVM8|APT_XANC8 Adenine phosphoribosyltransferase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=apt PE=3 SV=1 2 138 6.0E-23
sp|Q044A4|APT_LACGA Adenine phosphoribosyltransferase OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=apt PE=3 SV=1 30 141 6.0E-23
sp|Q7NGZ0|APT_GLOVI Adenine phosphoribosyltransferase OS=Gloeobacter violaceus (strain PCC 7421) GN=apt PE=3 SV=1 30 148 7.0E-23
sp|Q9JYB4|APT_NEIMB Adenine phosphoribosyltransferase OS=Neisseria meningitidis serogroup B (strain MC58) GN=apt PE=3 SV=1 2 135 7.0E-23
sp|A4X5X7|APT_SALTO Adenine phosphoribosyltransferase OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=apt PE=3 SV=1 1 148 7.0E-23
sp|B0UKF2|APT_METS4 Adenine phosphoribosyltransferase OS=Methylobacterium sp. (strain 4-46) GN=apt PE=3 SV=1 30 139 8.0E-23
sp|Q6NGY0|APT_CORDI Adenine phosphoribosyltransferase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=apt PE=3 SV=1 1 151 8.0E-23
sp|A6UBS2|APT_SINMW Adenine phosphoribosyltransferase OS=Sinorhizobium medicae (strain WSM419) GN=apt PE=3 SV=1 30 139 9.0E-23
sp|Q2IS06|APT_RHOP2 Adenine phosphoribosyltransferase OS=Rhodopseudomonas palustris (strain HaA2) GN=apt PE=3 SV=1 30 139 9.0E-23
sp|Q130R0|APT_RHOPS Adenine phosphoribosyltransferase OS=Rhodopseudomonas palustris (strain BisB5) GN=apt PE=3 SV=1 30 139 9.0E-23
sp|A9M1N3|APT_NEIM0 Adenine phosphoribosyltransferase OS=Neisseria meningitidis serogroup C (strain 053442) GN=apt PE=3 SV=2 2 135 9.0E-23
sp|Q5F774|APT_NEIG1 Adenine phosphoribosyltransferase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=apt PE=3 SV=2 2 135 9.0E-23
sp|A2SMH6|APT_METPP Adenine phosphoribosyltransferase OS=Methylibium petroleiphilum (strain PM1) GN=apt PE=3 SV=1 2 139 9.0E-23
sp|B4S410|APT_PROA2 Adenine phosphoribosyltransferase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=apt PE=3 SV=1 30 139 1.0E-22
sp|B9MIH9|APT_ACIET Adenine phosphoribosyltransferase OS=Acidovorax ebreus (strain TPSY) GN=apt PE=3 SV=1 2 139 1.0E-22
sp|Q827T5|APT_STRAW Adenine phosphoribosyltransferase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=apt PE=3 SV=1 2 142 1.0E-22
sp|Q167V0|APT_ROSDO Adenine phosphoribosyltransferase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=apt PE=3 SV=1 30 139 1.0E-22
sp|Q03W57|APT_LEUMM Adenine phosphoribosyltransferase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=apt PE=3 SV=1 2 142 1.0E-22
sp|Q9JT95|APT_NEIMA Adenine phosphoribosyltransferase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=apt PE=3 SV=2 2 135 1.0E-22
sp|C5BCZ7|APT_EDWI9 Adenine phosphoribosyltransferase OS=Edwardsiella ictaluri (strain 93-146) GN=apt PE=3 SV=1 32 139 1.0E-22
sp|Q2N669|APT_ERYLH Adenine phosphoribosyltransferase OS=Erythrobacter litoralis (strain HTCC2594) GN=apt PE=3 SV=1 30 149 1.0E-22
sp|A1KV71|APT_NEIMF Adenine phosphoribosyltransferase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=apt PE=3 SV=2 2 135 1.0E-22
sp|Q6F1J0|APT_MESFL Adenine phosphoribosyltransferase OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=apt PE=3 SV=1 2 148 1.0E-22
sp|A6LP26|APT_THEM4 Adenine phosphoribosyltransferase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=apt PE=3 SV=1 2 140 1.0E-22
sp|Q3A4N0|APT_PELCD Adenine phosphoribosyltransferase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=apt PE=3 SV=2 30 139 1.0E-22
sp|B0UWQ8|APT_HISS2 Adenine phosphoribosyltransferase OS=Histophilus somni (strain 2336) GN=apt PE=3 SV=1 32 141 1.0E-22
sp|Q0I3U5|APT_HAES1 Adenine phosphoribosyltransferase OS=Haemophilus somnus (strain 129Pt) GN=apt PE=3 SV=2 32 141 1.0E-22
sp|B4UE87|APT_ANASK Adenine phosphoribosyltransferase OS=Anaeromyxobacter sp. (strain K) GN=apt PE=3 SV=1 2 148 2.0E-22
sp|B8JDQ9|APT_ANAD2 Adenine phosphoribosyltransferase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=apt PE=3 SV=1 2 148 2.0E-22
sp|Q8EUA8|APT_MYCPE Adenine phosphoribosyltransferase OS=Mycoplasma penetrans (strain HF-2) GN=apt PE=3 SV=1 30 139 2.0E-22
sp|Q5LNY7|APT_RUEPO Adenine phosphoribosyltransferase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=apt PE=3 SV=1 30 139 2.0E-22
sp|Q74CZ3|APT_GEOSL Adenine phosphoribosyltransferase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=apt PE=3 SV=1 32 148 2.0E-22
sp|A5EE90|APT_BRASB Adenine phosphoribosyltransferase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=apt PE=3 SV=1 30 139 2.0E-22
sp|A0RQ44|APT_CAMFF Adenine phosphoribosyltransferase OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=apt PE=3 SV=1 3 139 2.0E-22
sp|A4YPM4|APT_BRASO Adenine phosphoribosyltransferase OS=Bradyrhizobium sp. (strain ORS278) GN=apt PE=3 SV=1 30 139 2.0E-22
sp|Q3AYP0|APT_SYNS9 Adenine phosphoribosyltransferase OS=Synechococcus sp. (strain CC9902) GN=apt PE=3 SV=1 2 139 2.0E-22
sp|Q4AAL9|APT_MYCHJ Adenine phosphoribosyltransferase OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=apt PE=3 SV=2 30 141 2.0E-22
sp|Q4A8Q0|APT_MYCH7 Adenine phosphoribosyltransferase OS=Mycoplasma hyopneumoniae (strain 7448) GN=apt PE=3 SV=2 30 141 2.0E-22
sp|Q601D6|APT_MYCH2 Adenine phosphoribosyltransferase OS=Mycoplasma hyopneumoniae (strain 232) GN=apt PE=3 SV=1 30 141 2.0E-22
sp|A8IEI6|APT_AZOC5 Adenine phosphoribosyltransferase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=apt PE=3 SV=2 30 139 2.0E-22
sp|B0CBF7|APT_ACAM1 Adenine phosphoribosyltransferase OS=Acaryochloris marina (strain MBIC 11017) GN=apt PE=3 SV=1 30 149 3.0E-22
sp|B3QA01|APT_RHOPT Adenine phosphoribosyltransferase OS=Rhodopseudomonas palustris (strain TIE-1) GN=apt PE=3 SV=1 30 139 3.0E-22
sp|Q6N1B4|APT_RHOPA Adenine phosphoribosyltransferase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=apt PE=3 SV=1 30 139 3.0E-22
sp|Q65U83|APT_MANSM Adenine phosphoribosyltransferase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=apt PE=3 SV=2 32 139 3.0E-22
sp|Q89SB5|APT_BRADU Adenine phosphoribosyltransferase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=apt PE=3 SV=1 30 139 4.0E-22
sp|A6KZN9|APT_BACV8 Adenine phosphoribosyltransferase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=apt PE=3 SV=1 32 137 4.0E-22
sp|Q1QIH5|APT_NITHX Adenine phosphoribosyltransferase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=apt PE=3 SV=1 30 139 4.0E-22
sp|A0LYK2|APT_GRAFK Adenine phosphoribosyltransferase OS=Gramella forsetii (strain KT0803) GN=apt PE=3 SV=1 30 139 4.0E-22
sp|A1TWI0|APT_ACIAC Adenine phosphoribosyltransferase OS=Acidovorax citrulli (strain AAC00-1) GN=apt PE=3 SV=1 2 142 4.0E-22
sp|Q9SU38|APT4_ARATH Adenine phosphoribosyltransferase 4 OS=Arabidopsis thaliana GN=APT4 PE=1 SV=1 31 149 4.0E-22
sp|Q8A2N8|APT_BACTN Adenine phosphoribosyltransferase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=apt PE=3 SV=1 32 141 4.0E-22
sp|Q2NV62|APT_SODGM Adenine phosphoribosyltransferase OS=Sodalis glossinidius (strain morsitans) GN=apt PE=3 SV=1 32 141 5.0E-22
sp|B1ZKA1|APT_METPB Adenine phosphoribosyltransferase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=apt PE=3 SV=1 30 141 5.0E-22
sp|A5UBP3|APT_HAEIE Adenine phosphoribosyltransferase OS=Haemophilus influenzae (strain PittEE) GN=apt PE=3 SV=1 32 141 5.0E-22
sp|A2C2A5|APT_PROM1 Adenine phosphoribosyltransferase OS=Prochlorococcus marinus (strain NATL1A) GN=apt PE=3 SV=1 2 139 5.0E-22
sp|A0RVQ8|APT_CENSY Adenine phosphoribosyltransferase OS=Cenarchaeum symbiosum (strain A) GN=apt PE=3 SV=1 2 139 6.0E-22
sp|A4FBB2|APT_SACEN Adenine phosphoribosyltransferase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=apt PE=3 SV=1 30 148 6.0E-22
sp|Q20Y76|APT_RHOPB Adenine phosphoribosyltransferase OS=Rhodopseudomonas palustris (strain BisB18) GN=apt PE=3 SV=1 30 141 6.0E-22
sp|A7HLE2|APT_FERNB Adenine phosphoribosyltransferase OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=apt PE=3 SV=1 2 141 6.0E-22
sp|C4LIX2|APT_CORK4 Adenine phosphoribosyltransferase OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=apt PE=3 SV=1 1 141 6.0E-22
sp|Q7UR74|APT_RHOBA Adenine phosphoribosyltransferase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=apt PE=3 SV=1 30 149 6.0E-22
sp|Q8DGH9|APT_THEEB Adenine phosphoribosyltransferase OS=Thermosynechococcus elongatus (strain BP-1) GN=apt PE=3 SV=1 30 148 7.0E-22
sp|Q0ARQ1|APT_MARMM Adenine phosphoribosyltransferase OS=Maricaulis maris (strain MCS10) GN=apt PE=3 SV=1 30 139 7.0E-22
sp|A1ASM0|APT_PELPD Adenine phosphoribosyltransferase OS=Pelobacter propionicus (strain DSM 2379) GN=apt PE=3 SV=1 30 149 8.0E-22
sp|A9W0A8|APT_METEP Adenine phosphoribosyltransferase OS=Methylobacterium extorquens (strain PA1) GN=apt PE=3 SV=1 30 141 8.0E-22
sp|B7KY35|APT_METC4 Adenine phosphoribosyltransferase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=apt PE=3 SV=1 30 141 8.0E-22
sp|B0BSS1|APT_ACTPJ Adenine phosphoribosyltransferase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=apt PE=3 SV=2 32 139 8.0E-22
sp|B3H0A8|APT_ACTP7 Adenine phosphoribosyltransferase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=apt PE=3 SV=1 32 139 8.0E-22
sp|A3MYY8|APT_ACTP2 Adenine phosphoribosyltransferase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=apt PE=3 SV=1 32 139 8.0E-22
sp|P43856|APT_HAEIN Adenine phosphoribosyltransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=apt PE=3 SV=1 32 141 1.0E-21
sp|A5UF74|APT_HAEIG Adenine phosphoribosyltransferase OS=Haemophilus influenzae (strain PittGG) GN=apt PE=3 SV=1 32 141 1.0E-21
sp|Q4QJV7|APT_HAEI8 Adenine phosphoribosyltransferase OS=Haemophilus influenzae (strain 86-028NP) GN=apt PE=3 SV=1 32 141 1.0E-21
sp|C4L531|APT_EXISA Adenine phosphoribosyltransferase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=apt PE=3 SV=1 30 139 1.0E-21
sp|Q9LFP0|APT5_ARATH Adenine phosphoribosyltransferase 5 OS=Arabidopsis thaliana GN=APT5 PE=1 SV=1 30 151 1.0E-21
sp|Q28MD3|APT_JANSC Adenine phosphoribosyltransferase OS=Jannaschia sp. (strain CCS1) GN=apt PE=3 SV=1 30 139 1.0E-21
sp|Q7VRB8|APT_BLOFL Adenine phosphoribosyltransferase OS=Blochmannia floridanus GN=apt PE=3 SV=1 32 129 1.0E-21
sp|Q3SPC5|APT_NITWN Adenine phosphoribosyltransferase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=apt PE=3 SV=1 30 139 1.0E-21
sp|A9GFF3|APT_SORC5 Adenine phosphoribosyltransferase OS=Sorangium cellulosum (strain So ce56) GN=apt PE=3 SV=1 2 142 2.0E-21
sp|Q60AN2|APT_METCA Adenine phosphoribosyltransferase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=apt PE=3 SV=1 32 148 2.0E-21
sp|B0SIB4|APT_LEPBA Adenine phosphoribosyltransferase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=apt PE=3 SV=1 32 142 2.0E-21
sp|A9WQH7|APT_RENSM Adenine phosphoribosyltransferase OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=apt PE=3 SV=1 1 139 2.0E-21
sp|Q2INZ6|APT_ANADE Adenine phosphoribosyltransferase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=apt PE=3 SV=1 2 148 3.0E-21
sp|Q1QVQ9|APT_CHRSD Adenine phosphoribosyltransferase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=apt PE=3 SV=1 2 142 3.0E-21
sp|Q7VKQ4|APT_HAEDU Adenine phosphoribosyltransferase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=apt PE=3 SV=1 32 139 3.0E-21
sp|B2IBU5|APT_BEII9 Adenine phosphoribosyltransferase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=apt PE=3 SV=1 30 139 3.0E-21
sp|A3PE89|APT_PROM0 Adenine phosphoribosyltransferase OS=Prochlorococcus marinus (strain MIT 9301) GN=apt PE=3 SV=1 1 140 3.0E-21
sp|Q7VGF2|APT_HELHP Adenine phosphoribosyltransferase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=apt PE=3 SV=1 30 139 4.0E-21
sp|Q46KW1|APT_PROMT Adenine phosphoribosyltransferase OS=Prochlorococcus marinus (strain NATL2A) GN=apt PE=3 SV=1 2 139 4.0E-21
sp|Q8EXN2|APT_LEPIN Adenine phosphoribosyltransferase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=apt PE=3 SV=1 32 141 5.0E-21
sp|Q75FP0|APT_LEPIC Adenine phosphoribosyltransferase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=apt PE=3 SV=1 32 141 5.0E-21
sp|Q7NRK9|APT_CHRVO Adenine phosphoribosyltransferase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=apt PE=3 SV=1 2 141 6.0E-21
sp|Q17W08|APT_HELAH Adenine phosphoribosyltransferase OS=Helicobacter acinonychis (strain Sheeba) GN=apt PE=3 SV=1 13 149 6.0E-21
sp|A6VMZ1|APT_ACTSZ Adenine phosphoribosyltransferase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=apt PE=3 SV=1 32 139 6.0E-21
sp|Q30RI5|APT_SULDN Adenine phosphoribosyltransferase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=apt PE=3 SV=1 30 141 7.0E-21
sp|Q04WP5|APT_LEPBL Adenine phosphoribosyltransferase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=apt PE=3 SV=1 32 141 7.0E-21
sp|Q04NG3|APT_LEPBJ Adenine phosphoribosyltransferase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=apt PE=3 SV=1 32 141 7.0E-21
sp|B5Y8Y0|APT_COPPD Adenine phosphoribosyltransferase OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=apt PE=3 SV=1 2 140 7.0E-21
sp|A1B843|APT_PARDP Adenine phosphoribosyltransferase OS=Paracoccus denitrificans (strain Pd 1222) GN=apt PE=3 SV=1 30 136 7.0E-21
sp|A6Q2W2|APT_NITSB Adenine phosphoribosyltransferase OS=Nitratiruptor sp. (strain SB155-2) GN=apt PE=3 SV=1 3 139 8.0E-21
sp|Q9RQF8|APT_RHIGA Adenine phosphoribosyltransferase OS=Rhizobium galegae GN=apt PE=3 SV=2 30 139 8.0E-21
sp|Q5QWS1|APT_IDILO Adenine phosphoribosyltransferase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=apt PE=3 SV=1 2 145 9.0E-21
sp|Q7VAL5|APT_PROMA Adenine phosphoribosyltransferase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=apt PE=3 SV=1 2 139 1.0E-20
sp|A9A3N4|APT_NITMS Adenine phosphoribosyltransferase OS=Nitrosopumilus maritimus (strain SCM1) GN=apt PE=3 SV=1 2 135 2.0E-20
sp|Q3AIK3|APT_SYNSC Adenine phosphoribosyltransferase OS=Synechococcus sp. (strain CC9605) GN=apt PE=3 SV=1 2 139 2.0E-20
sp|A8LPV7|APT_DINSH Adenine phosphoribosyltransferase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=apt PE=3 SV=1 30 139 2.0E-20
sp|A2BRV3|APT_PROMS Adenine phosphoribosyltransferase OS=Prochlorococcus marinus (strain AS9601) GN=apt PE=3 SV=1 25 139 2.0E-20
sp|Q31JG9|APT_THICR Adenine phosphoribosyltransferase OS=Thiomicrospira crunogena (strain XCL-2) GN=apt PE=3 SV=2 30 150 2.0E-20
sp|B0S0M3|APT_FINM2 Adenine phosphoribosyltransferase OS=Finegoldia magna (strain ATCC 29328) GN=apt PE=3 SV=1 32 137 3.0E-20
sp|P57841|APT_PASMU Adenine phosphoribosyltransferase OS=Pasteurella multocida (strain Pm70) GN=apt PE=3 SV=1 32 140 3.0E-20
sp|Q42563|APT2_ARATH Adenine phosphoribosyltransferase 2 OS=Arabidopsis thaliana GN=APT2 PE=1 SV=1 30 149 3.0E-20
sp|A7ZCG7|APT_CAMC1 Adenine phosphoribosyltransferase OS=Campylobacter concisus (strain 13826) GN=apt PE=3 SV=1 30 139 3.0E-20
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7240
MPIFASAAAHACLLDALEERIRCDFVPLPDVIVGLDARGFLFAPGLALRLGVGFAAVRKVGKLPGSCVDVRYEKE
YGGDCFQMQSGAVAAGQNVLVVDDIIATGGSAKAAGDLVRQLNGRVLGYLFILEIAGLNGREKLGDAKTAILLDD
A*
Coding >Ophun1|7240
ATGCCCATCTTCGCCTCGGCGGCCGCGCACGCCTGCCTCCTCGACGCGCTGGAGGAGCGCATCCGCTGCGACTTC
GTCCCGCTGCCGGACGTCATCGTCGGGCTTGACGCCCGGGGCTTCCTCTTTGCGCCGGGGCTGGCGCTGAGGCTG
GGGGTTGGCTTCGCGGCTGTGCGCAAGGTGGGCAAGTTGCCGGGCTCGTGTGTTGATGTTAGGTATGAGAAGGAG
TATGGAGGGGATTGCTTTCAGATGCAGTCCGGGGCTGTGGCTGCTGGTCAGAATGTGCTTGTTGTGGACGATATT
ATCGCTACTGGCGGTTCGGCCAAGGCGGCTGGTGATCTTGTGAGGCAGCTAAACGGTCGTGTGCTGGGATACCTC
TTCATCCTCGAGATTGCAGGCCTCAACGGCCGGGAGAAGCTCGGCGATGCAAAGACGGCCATCTTACTCGACGAC
GCTTGA
Transcript >Ophun1|7240
ATGCCCATCTTCGCCTCGGCGGCCGCGCACGCCTGCCTCCTCGACGCGCTGGAGGAGCGCATCCGCTGCGACTTC
GTCCCGCTGCCGGACGTCATCGTCGGGCTTGACGCCCGGGGCTTCCTCTTTGCGCCGGGGCTGGCGCTGAGGCTG
GGGGTTGGCTTCGCGGCTGTGCGCAAGGTGGGCAAGTTGCCGGGCTCGTGTGTTGATGTTAGGTATGAGAAGGAG
TATGGAGGGGATTGCTTTCAGATGCAGTCCGGGGCTGTGGCTGCTGGTCAGAATGTGCTTGTTGTGGACGATATT
ATCGCTACTGGCGGTTCGGCCAAGGCGGCTGGTGATCTTGTGAGGCAGCTAAACGGTCGTGTGCTGGGATACCTC
TTCATCCTCGAGATTGCAGGCCTCAACGGCCGGGAGAAGCTCGGCGATGCAAAGACGGCCATCTTACTCGACGAC
GCTTGA
Gene >Ophun1|7240
ATGCCCATCTTCGCCTCGGCGGCCGCGCACGCCTGCCTCCTCGACGCGCTGGAGGAGCGCATCCGCTGCGACTTC
GTCCCGCTGCCGGACGTCATCGTCGGGCTTGACGCCCGGGGCTTCCTCTTTGCGCCGGGGCTGGCGCTGAGGCTG
GGGGTTGGCTTCGCGGCTGTGCGCAAGGTGGGCAAGTTGCCGGGCTCGTGTGTTGATGTTAGGTATGAGAAGGAG
TATGGAGGGGATTGCTTTCAGATGCAGTCCGGGGCTGTGGCTGCTGGTCAGAATGTGCTTGTTGTGGACGATATT
ATCGCTACTGGTATGTTTTTTTTTTCGTCCTCTTTATGACGTTGACCGTCGATTCTTGGGGCGTGGACTGATGAT
GATGATGGTAGGCGGTTCGGCCAAGGCGGCTGGTGATCTTGTGAGGCAGCTAAACGGTCGTGTGCTGGGATACCT
CTTCATCCTCGAGATTGCAGGCCTCAACGGCCGGGAGAAGCTCGGCGATGCAAAGACGGCCATCTTACTCGACGA
CGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail