Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7223
Gene name
LocationContig_88:18702..22108
Strand-
Gene length (bp)3406
Transcript length (bp)2916
Coding sequence length (bp)2916
Protein length (aa) 972

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00160 Pro_isomerase Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD 8.0E-49 806 969
PF13668 Ferritin_2 Ferritin-like domain 5.0E-45 33 165

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0C1J0|CYP15_RHIO9 Peptidyl-prolyl cis-trans isomerase cyp15 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp15 PE=3 SV=1 338 956 0.0E+00
sp|Q29RZ2|PPWD1_BOVIN Peptidylprolyl isomerase domain and WD repeat-containing protein 1 OS=Bos taurus GN=PPWD1 PE=2 SV=1 365 970 0.0E+00
sp|Q96BP3|PPWD1_HUMAN Peptidylprolyl isomerase domain and WD repeat-containing protein 1 OS=Homo sapiens GN=PPWD1 PE=1 SV=1 342 970 0.0E+00
sp|Q8CEC6|PPWD1_MOUSE Peptidylprolyl isomerase domain and WD repeat-containing protein 1 OS=Mus musculus GN=Ppwd1 PE=1 SV=2 365 970 0.0E+00
sp|Q5NVL7|PPWD1_PONAB Peptidylprolyl isomerase domain and WD repeat-containing protein 1 OS=Pongo abelii GN=PPWD1 PE=2 SV=1 342 970 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0C1J0|CYP15_RHIO9 Peptidyl-prolyl cis-trans isomerase cyp15 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp15 PE=3 SV=1 338 956 0.0E+00
sp|Q29RZ2|PPWD1_BOVIN Peptidylprolyl isomerase domain and WD repeat-containing protein 1 OS=Bos taurus GN=PPWD1 PE=2 SV=1 365 970 0.0E+00
sp|Q96BP3|PPWD1_HUMAN Peptidylprolyl isomerase domain and WD repeat-containing protein 1 OS=Homo sapiens GN=PPWD1 PE=1 SV=1 342 970 0.0E+00
sp|Q8CEC6|PPWD1_MOUSE Peptidylprolyl isomerase domain and WD repeat-containing protein 1 OS=Mus musculus GN=Ppwd1 PE=1 SV=2 365 970 0.0E+00
sp|Q5NVL7|PPWD1_PONAB Peptidylprolyl isomerase domain and WD repeat-containing protein 1 OS=Pongo abelii GN=PPWD1 PE=2 SV=1 342 970 0.0E+00
sp|Q8W4D0|CPY71_ARATH Peptidyl-prolyl cis-trans isomerase CYP71 OS=Arabidopsis thaliana GN=CYP71 PE=1 SV=1 371 970 2.0E-163
sp|O74942|CYP9_SCHPO Peptidyl-prolyl cis-trans isomerase 9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cyp9 PE=1 SV=1 371 970 2.0E-162
sp|Q4L4W9|PPI1_STAHJ Putative peptidyl-prolyl cis-trans isomerase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH1997 PE=3 SV=1 790 970 2.0E-46
sp|Q49W93|PPI1_STAS1 Putative peptidyl-prolyl cis-trans isomerase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP1821 PE=3 SV=1 805 970 2.0E-45
sp|Q8CT84|PPI1_STAES Putative peptidyl-prolyl cis-trans isomerase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_0648 PE=3 SV=1 804 970 8.0E-45
sp|Q5HQK8|PPI1_STAEQ Putative peptidyl-prolyl cis-trans isomerase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP0540 PE=3 SV=1 804 970 8.0E-45
sp|Q9NI62|CYPE_DICDI Peptidyl-prolyl cis-trans isomerase cypE OS=Dictyostelium discoideum GN=cypE PE=1 SV=1 802 966 1.0E-44
sp|Q7A1C0|PPI1_STAAW Putative peptidyl-prolyl cis-trans isomerase OS=Staphylococcus aureus (strain MW2) GN=MW0836 PE=3 SV=1 805 970 4.0E-43
sp|Q6GAX2|PPI1_STAAS Putative peptidyl-prolyl cis-trans isomerase OS=Staphylococcus aureus (strain MSSA476) GN=SAS0824 PE=3 SV=1 805 970 4.0E-43
sp|Q6GID4|PPI1_STAAR Putative peptidyl-prolyl cis-trans isomerase OS=Staphylococcus aureus (strain MRSA252) GN=SAR0916 PE=3 SV=1 805 970 4.0E-43
sp|Q7A6I1|PPI1_STAAN Putative peptidyl-prolyl cis-trans isomerase OS=Staphylococcus aureus (strain N315) GN=SA0815 PE=1 SV=1 805 970 4.0E-43
sp|Q99VD4|PPI1_STAAM Putative peptidyl-prolyl cis-trans isomerase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV0954 PE=3 SV=1 805 970 4.0E-43
sp|Q2YWT2|PPI1_STAAB Putative peptidyl-prolyl cis-trans isomerase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB0821 PE=3 SV=1 805 970 4.0E-43
sp|Q2FZU9|PPI1_STAA8 Putative peptidyl-prolyl cis-trans isomerase OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_00891 PE=3 SV=1 805 970 4.0E-43
sp|Q2FIC1|PPI1_STAA3 Putative peptidyl-prolyl cis-trans isomerase OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_0857 PE=3 SV=1 805 970 4.0E-43
sp|Q5HHD1|PPI1_STAAC Putative peptidyl-prolyl cis-trans isomerase OS=Staphylococcus aureus (strain COL) GN=SACOL0957 PE=3 SV=1 805 970 4.0E-43
sp|Q4I1Y1|PPIL1_GIBZE Peptidyl-prolyl cis-trans isomerase-like 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CYP1 PE=3 SV=1 805 970 1.0E-41
sp|Q7SF72|PPIL1_NEUCR Peptidyl-prolyl cis-trans isomerase-like 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ppi-1 PE=3 SV=2 806 970 2.0E-41
sp|P0C1J1|PPIL2_RHIO9 Peptidyl-prolyl cis-trans isomerase-like 2 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp14 PE=3 SV=1 798 970 4.0E-40
sp|Q4WCR3|PPIL1_ASPFU Peptidyl-prolyl cis-trans isomerase-like 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cyp1 PE=3 SV=1 801 970 1.0E-39
sp|Q5XAQ1|BPPI_STRP6 Putative bifunctional phosphatase/peptidyl-prolyl cis-trans isomerase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=M6_Spy1377 PE=1 SV=1 731 970 2.0E-39
sp|Q5ASQ0|PPIL1_EMENI Peptidyl-prolyl cis-trans isomerase-like 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cyp1 PE=3 SV=1 808 970 3.0E-39
sp|P87051|PPIL1_SCHPO Peptidyl-prolyl cis-trans isomerase ppi1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppi1 PE=1 SV=1 806 966 4.0E-39
sp|P0C1I4|PPIL1_RHIO9 Peptidyl-prolyl cis-trans isomerase-like 1 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp3 PE=3 SV=1 802 954 4.0E-39
sp|Q2U6U0|PPIL1_ASPOR Peptidyl-prolyl cis-trans isomerase-like 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cyp1 PE=3 SV=1 808 970 7.0E-39
sp|Q8X191|PPIL1_ASPNG Peptidyl-prolyl cis-trans isomerase-like 1 OS=Aspergillus niger GN=cypC PE=3 SV=1 808 966 2.0E-38
sp|Q9LPC7|CP18A_ARATH Peptidyl-prolyl cis-trans isomerase CYP18-1 OS=Arabidopsis thaliana GN=CYP18-1 PE=2 SV=1 803 970 2.0E-38
sp|Q9Y3C6|PPIL1_HUMAN Peptidyl-prolyl cis-trans isomerase-like 1 OS=Homo sapiens GN=PPIL1 PE=1 SV=1 806 966 6.0E-38
sp|Q5E992|PPIL1_BOVIN Peptidyl-prolyl cis-trans isomerase-like 1 OS=Bos taurus GN=PPIL1 PE=2 SV=1 806 966 6.0E-38
sp|Q9D0W5|PPIL1_MOUSE Peptidyl-prolyl cis-trans isomerase-like 1 OS=Mus musculus GN=Ppil1 PE=1 SV=1 806 966 1.0E-37
sp|Q9SIH1|CP18B_ARATH Peptidyl-prolyl cis-trans isomerase CYP18-2 OS=Arabidopsis thaliana GN=CYP18-2 PE=2 SV=1 806 970 3.0E-37
sp|Q5ZLV2|PPIL3_CHICK Peptidyl-prolyl cis-trans isomerase-like 3 OS=Gallus gallus GN=PPIL3 PE=2 SV=1 803 970 3.0E-37
sp|P52012|PPIL2_CAEEL Peptidyl-prolyl cis-trans isomerase 4 OS=Caenorhabditis elegans GN=cyn-4 PE=1 SV=3 806 954 7.0E-37
sp|P52017|CYP10_CAEEL Peptidyl-prolyl cis-trans isomerase 10 OS=Caenorhabditis elegans GN=cyn-10 PE=2 SV=2 803 970 8.0E-37
sp|P0CP86|PPIL3_CRYNJ Peptidyl-prolyl cis-trans isomerase-like 3 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CYP10 PE=3 SV=1 803 970 1.0E-36
sp|P0CP87|PPIL3_CRYNB Peptidyl-prolyl cis-trans isomerase-like 3 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CYP10 PE=3 SV=1 803 970 1.0E-36
sp|P0CP90|PPIL2_CRYNJ Peptidyl-prolyl cis-trans isomerase-like 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CYP8 PE=3 SV=1 794 970 6.0E-36
sp|P0CP91|PPIL2_CRYNB Peptidyl-prolyl cis-trans isomerase-like 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CYP8 PE=3 SV=1 794 970 6.0E-36
sp|P0CP84|PPIL1_CRYNJ Peptidyl-prolyl cis-trans isomerase-like 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CYP1 PE=3 SV=1 808 965 6.0E-36
sp|P0CP85|PPIL1_CRYNB Peptidyl-prolyl cis-trans isomerase-like 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CYP1 PE=3 SV=1 808 965 6.0E-36
sp|Q9H2H8|PPIL3_HUMAN Peptidyl-prolyl cis-trans isomerase-like 3 OS=Homo sapiens GN=PPIL3 PE=1 SV=1 803 970 7.0E-36
sp|Q812D3|PPIL3_RAT Peptidyl-prolyl cis-trans isomerase-like 3 OS=Rattus norvegicus GN=Ppil3 PE=2 SV=1 803 970 9.0E-36
sp|Q9D6L8|PPIL3_MOUSE Peptidyl-prolyl cis-trans isomerase-like 3 OS=Mus musculus GN=Ppil3 PE=1 SV=1 803 970 1.0E-35
sp|P24368|PPIB_RAT Peptidyl-prolyl cis-trans isomerase B OS=Rattus norvegicus GN=Ppib PE=1 SV=3 807 967 3.0E-35
sp|Q09928|PPIL2_SCHPO Peptidyl-prolyl cis-trans isomerase cyp8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cyp8 PE=2 SV=3 796 968 7.0E-35
sp|P24369|PPIB_MOUSE Peptidyl-prolyl cis-trans isomerase B OS=Mus musculus GN=Ppib PE=1 SV=2 809 967 1.0E-34
sp|O94273|PPIB_SCHPO Peptidyl-prolyl cis-trans isomerase B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cyp4 PE=3 SV=1 811 966 2.0E-34
sp|P24367|PPIB_CHICK Peptidyl-prolyl cis-trans isomerase B OS=Gallus gallus GN=PPIB PE=2 SV=1 811 967 2.0E-34
sp|Q4P0V4|PPID_USTMA Peptidyl-prolyl cis-trans isomerase D OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CPR6 PE=3 SV=1 813 968 3.0E-34
sp|Q41651|CYPB_VICFA Peptidyl-prolyl cis-trans isomerase, chloroplastic OS=Vicia faba PE=1 SV=1 787 965 3.0E-34
sp|P18253|CYPH_SCHPO Peptidyl-prolyl cis-trans isomerase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppi1 PE=3 SV=1 811 952 3.0E-34
sp|Q6C4W6|PPIB_YARLI Peptidyl-prolyl cis-trans isomerase B OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CPR2 PE=3 SV=1 809 967 3.0E-34
sp|P80311|PPIB_BOVIN Peptidyl-prolyl cis-trans isomerase B OS=Bos taurus GN=PPIB PE=1 SV=4 811 967 4.0E-34
sp|P0C1H9|PPIB1_RHIO9 Peptidyl-prolyl cis-trans isomerase B1 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp8 PE=3 SV=1 809 970 4.0E-34
sp|Q9P3X9|PPID_NEUCR 41 kDa peptidyl-prolyl cis-trans isomerase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cyp41 PE=1 SV=1 811 968 4.0E-34
sp|Q11004|PPID_SCHPO 40 kDa peptidyl-prolyl cis-trans isomerase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wis2 PE=2 SV=1 813 959 6.0E-34
sp|O93826|PPIB_ARTBE Peptidyl-prolyl cis-trans isomerase B OS=Arthroderma benhamiae GN=CPR2 PE=2 SV=1 811 966 9.0E-34
sp|D4AY02|CYPB_ARTBC Probable peptidyl-prolyl cis-trans isomerase ARB_01071 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01071 PE=1 SV=2 811 966 9.0E-34
sp|Q54E95|PPIL3_DICDI Peptidyl-prolyl cis-trans isomerase-like 3 OS=Dictyostelium discoideum GN=ppil3 PE=3 SV=1 803 952 1.0E-33
sp|P23284|PPIB_HUMAN Peptidyl-prolyl cis-trans isomerase B OS=Homo sapiens GN=PPIB PE=1 SV=2 811 967 2.0E-33
sp|Q9FJX0|PPIL2_ARATH Peptidyl-prolyl cis-trans isomerase CYP65 OS=Arabidopsis thaliana GN=CYP65 PE=2 SV=1 806 970 2.0E-33
sp|Q4WCM6|PPIH_ASPFU Peptidyl-prolyl cis-trans isomerase H OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cyp3 PE=3 SV=2 811 965 2.0E-33
sp|P0C1I1|PPID_RHIO9 Peptidyl-prolyl cis-trans isomerase D OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp12 PE=3 SV=1 811 966 3.0E-33
sp|Q5B4R3|PPIB_EMENI Peptidyl-prolyl cis-trans isomerase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cpr2 PE=3 SV=1 809 966 4.0E-33
sp|Q5AQL0|PPIH_EMENI Peptidyl-prolyl cis-trans isomerase H OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cyp3 PE=3 SV=2 811 966 6.0E-33
sp|Q4HXF6|PPID_GIBZE Peptidyl-prolyl cis-trans isomerase D OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CPR6 PE=3 SV=1 809 968 9.0E-33
sp|Q4G338|PPIE_HAECO Peptidyl-prolyl cis-trans isomerase E OS=Haemonchus contortus PE=1 SV=1 811 966 1.0E-32
sp|Q5B4E7|PPID_EMENI Peptidyl-prolyl cis-trans isomerase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cpr6 PE=3 SV=1 805 966 1.0E-32
sp|Q2TZ33|PPIH_ASPOR Peptidyl-prolyl cis-trans isomerase H OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cyp3 PE=3 SV=1 809 966 1.0E-32
sp|Q2UGK2|PPIB_ASPOR Peptidyl-prolyl cis-trans isomerase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cpr2 PE=3 SV=1 811 966 1.0E-32
sp|P52014|CYP6_CAEEL Peptidyl-prolyl cis-trans isomerase 6 OS=Caenorhabditis elegans GN=cyn-6 PE=2 SV=1 811 967 2.0E-32
sp|Q4PCH8|PPIL3_USTMA Peptidyl-prolyl cis-trans isomerase-like 3 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CYP10 PE=3 SV=1 806 970 2.0E-32
sp|P0C1I2|PPIE_RHIO9 Peptidyl-prolyl cis-trans isomerase E OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp10 PE=3 SV=1 765 968 3.0E-32
sp|Q38867|CP19C_ARATH Peptidyl-prolyl cis-trans isomerase CYP19-3 OS=Arabidopsis thaliana GN=CYP19-3 PE=2 SV=2 805 965 3.0E-32
sp|Q75A33|PPID_ASHGO Peptidyl-prolyl cis-trans isomerase D OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CPR6 PE=3 SV=1 795 965 3.0E-32
sp|P22011|PPIA_CANAL Peptidyl-prolyl cis-trans isomerase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CYP1 PE=3 SV=1 811 951 4.0E-32
sp|Q4WIF3|PPID_ASPFU Peptidyl-prolyl cis-trans isomerase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cpr6 PE=3 SV=1 815 968 5.0E-32
sp|Q7S7Z6|PPIB_NEUCR Peptidyl-prolyl cis-trans isomerase B OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpr2 PE=3 SV=3 811 965 5.0E-32
sp|Q5AXT6|PPIL2_EMENI Peptidyl-prolyl cis-trans isomerase-like 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cyp8 PE=3 SV=1 796 970 5.0E-32
sp|Q9TW32|PPIB_DICDI Peptidyl-prolyl cis-trans isomerase B OS=Dictyostelium discoideum GN=cypB PE=1 SV=1 811 967 5.0E-32
sp|Q4WP12|PPIB_ASPFU Peptidyl-prolyl cis-trans isomerase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cpr2 PE=3 SV=1 811 966 6.0E-32
sp|Q27774|PPIB_SCHJA Peptidyl-prolyl cis-trans isomerase B OS=Schistosoma japonicum PE=2 SV=1 811 967 7.0E-32
sp|P0CP81|PPID_CRYNB Peptidyl-prolyl cis-trans isomerase D OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CPR6 PE=3 SV=1 811 970 1.0E-31
sp|P35627|CYPX_USEUD Peptidyl-prolyl cis-trans isomerase OS=Unspecified eudicot DB-1992 PE=2 SV=1 811 965 1.0E-31
sp|P0C1I5|PPIL3_RHIO9 Peptidyl-prolyl cis-trans isomerase-like 3 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp4 PE=3 SV=1 803 970 1.0E-31
sp|P0C1I0|PPIB2_RHIO9 Peptidyl-prolyl cis-trans isomerase B2 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp9 PE=3 SV=1 799 967 1.0E-31
sp|Q01490|PPIB_ORPSP Peptidyl-prolyl cis-trans isomerase B OS=Orpinomyces sp. (strain PC-2) GN=CYPB PE=1 SV=1 811 955 1.0E-31
sp|O66105|PPIB_TREPA Probable peptidyl-prolyl cis-trans isomerase OS=Treponema pallidum (strain Nichols) GN=ppiB PE=1 SV=1 785 956 1.0E-31
sp|Q26565|PPIA_SCHMA Peptidyl-prolyl cis-trans isomerase OS=Schistosoma mansoni PE=1 SV=1 811 965 2.0E-31
sp|P0C1H7|PPIA1_RHIO9 Peptidyl-prolyl cis-trans isomerase A1 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp2 PE=3 SV=1 811 968 2.0E-31
sp|P25719|CYPC_YEAST Peptidyl-prolyl cis-trans isomerase C, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CPR3 PE=1 SV=1 797 965 2.0E-31
sp|Q9TTC6|PPIA_RABIT Peptidyl-prolyl cis-trans isomerase A OS=Oryctolagus cuniculus GN=PPIA PE=2 SV=3 811 967 2.0E-31
sp|Q9ASS6|PNSL5_ARATH Photosynthetic NDH subunit of lumenal location 5, chloroplastic OS=Arabidopsis thaliana GN=PNSL5 PE=1 SV=1 811 968 2.0E-31
sp|Q26516|PPIE_SCHJA Peptidyl-prolyl cis-trans isomerase E (Fragment) OS=Schistosoma japonicum PE=2 SV=1 811 965 2.0E-31
sp|P0CP80|PPID_CRYNJ Peptidyl-prolyl cis-trans isomerase D OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CPR6 PE=3 SV=1 811 970 2.0E-31
sp|P0C1H8|PPIA2_RHIO9 Peptidyl-prolyl cis-trans isomerase A2 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp1 PE=3 SV=1 811 952 3.0E-31
sp|Q6CBP4|PPID_YARLI Peptidyl-prolyl cis-trans isomerase D OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CPR6 PE=3 SV=1 802 968 3.0E-31
sp|Q8X166|PPIB_ASPNG Peptidyl-prolyl cis-trans isomerase B OS=Aspergillus niger GN=cypB PE=3 SV=1 811 966 4.0E-31
sp|Q2U5W8|PPIL2_ASPOR Peptidyl-prolyl cis-trans isomerase-like 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cyp8 PE=3 SV=1 796 970 4.0E-31
sp|O00845|PPIA_PARPR Peptidyl-prolyl cis-trans isomerase OS=Paramecium primaurelia PE=3 SV=1 813 970 5.0E-31
sp|Q4WVU5|PPIL2_ASPFU Peptidyl-prolyl cis-trans isomerase-like 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cyp8 PE=3 SV=2 796 970 8.0E-31
sp|Q2U0E0|PPID_ASPOR Peptidyl-prolyl cis-trans isomerase D OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cpr6 PE=3 SV=1 823 966 8.0E-31
sp|P30412|PPIC_MOUSE Peptidyl-prolyl cis-trans isomerase C OS=Mus musculus GN=Ppic PE=1 SV=1 811 970 9.0E-31
sp|Q6Q152|CPY57_ARATH Peptidyl-prolyl cis-trans isomerase CYP57 OS=Arabidopsis thaliana GN=CYP57 PE=1 SV=1 805 940 1.0E-30
sp|P34887|CYPH_ALLCE Peptidyl-prolyl cis-trans isomerase OS=Allium cepa GN=CYP PE=2 SV=1 815 967 1.0E-30
sp|Q4I5R9|PPIB_GIBZE Peptidyl-prolyl cis-trans isomerase B OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CPR2 PE=3 SV=2 811 965 1.0E-30
sp|Q4IBK5|PPIL2_GIBZE Peptidyl-prolyl cis-trans isomerase-like 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CYP8 PE=3 SV=1 804 954 1.0E-30
sp|P52009|CYP1_CAEEL Peptidyl-prolyl cis-trans isomerase 1 OS=Caenorhabditis elegans GN=cyn-1 PE=2 SV=1 795 968 2.0E-30
sp|Q0ZQK6|PPIA_SYMSY Peptidyl-prolyl cis-trans isomerase A OS=Symphalangus syndactylus GN=PPIA PE=3 SV=3 811 967 2.0E-30
sp|Q5R8S7|PPIA_PONPY Peptidyl-prolyl cis-trans isomerase A OS=Pongo pygmaeus GN=PPIA PE=2 SV=4 811 967 2.0E-30
sp|P62941|PPIA_PAPAN Peptidyl-prolyl cis-trans isomerase A OS=Papio anubis GN=PPIA PE=2 SV=2 811 967 2.0E-30
sp|Q0ZQL1|PPIA_PANTR Peptidyl-prolyl cis-trans isomerase A OS=Pan troglodytes GN=PPIA PE=3 SV=3 811 967 2.0E-30
sp|Q0ZQL2|PPIA_PANPA Peptidyl-prolyl cis-trans isomerase A OS=Pan paniscus GN=PPIA PE=3 SV=3 811 967 2.0E-30
sp|Q0ZQK7|PPIA_NOMLE Peptidyl-prolyl cis-trans isomerase A OS=Nomascus leucogenys GN=PPIA PE=3 SV=3 811 967 2.0E-30
sp|P62940|PPIA_MACMU Peptidyl-prolyl cis-trans isomerase A OS=Macaca mulatta GN=PPIA PE=1 SV=2 811 967 2.0E-30
sp|Q0ZQK8|PPIA_HYLLA Peptidyl-prolyl cis-trans isomerase A OS=Hylobates lar GN=PPIA PE=3 SV=3 811 967 2.0E-30
sp|P62937|PPIA_HUMAN Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens GN=PPIA PE=1 SV=2 811 967 2.0E-30
sp|Q0ZQL0|PPIA_GORGO Peptidyl-prolyl cis-trans isomerase A OS=Gorilla gorilla gorilla GN=PPIA PE=3 SV=3 811 967 2.0E-30
sp|P62938|PPIA_CHLAE Peptidyl-prolyl cis-trans isomerase A OS=Chlorocebus aethiops GN=PPIA PE=2 SV=2 811 967 2.0E-30
sp|P0C1I8|CYP6_RHIO9 Peptidyl-prolyl cis-trans isomerase cyp6 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp6 PE=3 SV=1 811 968 2.0E-30
sp|P34791|CP20C_ARATH Peptidyl-prolyl cis-trans isomerase CYP20-3, chloroplastic OS=Arabidopsis thaliana GN=CYP20-3 PE=1 SV=1 811 954 3.0E-30
sp|P52011|CYP3_CAEEL Peptidyl-prolyl cis-trans isomerase 3 OS=Caenorhabditis elegans GN=cyn-3 PE=1 SV=1 796 968 3.0E-30
sp|P14832|CYPH_YEAST Peptidyl-prolyl cis-trans isomerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CPR1 PE=1 SV=3 811 952 3.0E-30
sp|Q26548|PPIE_SCHMA Peptidyl-prolyl cis-trans isomerase E OS=Schistosoma mansoni PE=1 SV=2 768 965 4.0E-30
sp|P52013|CYP5_CAEEL Peptidyl-prolyl cis-trans isomerase 5 OS=Caenorhabditis elegans GN=cyn-5 PE=1 SV=2 811 965 4.0E-30
sp|P91791|PPIA_HEMPU Peptidyl-prolyl cis-trans isomerase OS=Hemicentrotus pulcherrimus PE=2 SV=1 811 968 4.0E-30
sp|P77949|PPIB_STRAQ Peptidyl-prolyl cis-trans isomerase B OS=Streptomyces anulatus GN=cypB PE=1 SV=1 804 970 4.0E-30
sp|P45877|PPIC_HUMAN Peptidyl-prolyl cis-trans isomerase C OS=Homo sapiens GN=PPIC PE=1 SV=1 811 970 4.0E-30
sp|P0C1I7|CYP5_RHIO9 Peptidyl-prolyl cis-trans isomerase cyp5 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp5 PE=3 SV=1 811 967 6.0E-30
sp|P62936|PPIA_PIG Peptidyl-prolyl cis-trans isomerase A OS=Sus scrofa GN=PPIA PE=1 SV=2 811 967 6.0E-30
sp|P62935|PPIA_BOVIN Peptidyl-prolyl cis-trans isomerase A OS=Bos taurus GN=PPIA PE=1 SV=2 811 967 6.0E-30
sp|Q6FNU6|PPID_CANGA Peptidyl-prolyl cis-trans isomerase D OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CPR6 PE=3 SV=1 796 965 6.0E-30
sp|Q39613|CYPH_CATRO Peptidyl-prolyl cis-trans isomerase OS=Catharanthus roseus GN=PCKR1 PE=1 SV=1 811 963 6.0E-30
sp|P52016|CYP8_CAEEL Peptidyl-prolyl cis-trans isomerase 8 OS=Caenorhabditis elegans GN=cyn-8 PE=2 SV=1 811 971 6.0E-30
sp|P52015|CYP7_CAEEL Peptidyl-prolyl cis-trans isomerase 7 OS=Caenorhabditis elegans GN=cyn-7 PE=1 SV=2 811 968 7.0E-30
sp|Q9SKQ0|CP19B_ARATH Peptidyl-prolyl cis-trans isomerase CYP19-2 OS=Arabidopsis thaliana GN=CYP19-2 PE=1 SV=1 811 968 7.0E-30
sp|Q0ZQK3|PPIA_SAGOE Peptidyl-prolyl cis-trans isomerase A OS=Saguinus oedipus GN=PPIA PE=3 SV=3 811 967 7.0E-30
sp|Q6DTV9|PPIA_AOTTR Peptidyl-prolyl cis-trans isomerase A OS=Aotus trivirgatus GN=PPIA PE=2 SV=3 811 967 7.0E-30
sp|Q9QZH3|PPIE_MOUSE Peptidyl-prolyl cis-trans isomerase E OS=Mus musculus GN=Ppie PE=1 SV=2 811 968 8.0E-30
sp|P73789|PPI2_SYNY3 Peptidyl-prolyl cis-trans isomerase slr1251 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr1251 PE=3 SV=1 809 950 8.0E-30
sp|Q4IPH4|PPIH_GIBZE Peptidyl-prolyl cis-trans isomerase H OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CYP3 PE=3 SV=1 811 965 9.0E-30
sp|Q08E11|PPIC_BOVIN Peptidyl-prolyl cis-trans isomerase C OS=Bos taurus GN=PPIC PE=2 SV=1 811 970 9.0E-30
sp|P24525|CYPH_BRANA Peptidyl-prolyl cis-trans isomerase OS=Brassica napus GN=CYP PE=2 SV=2 811 952 9.0E-30
sp|P14088|PPIA_ECHGR Peptidyl-prolyl cis-trans isomerase OS=Echinococcus granulosus GN=CYP-1 PE=2 SV=2 811 967 1.0E-29
sp|Q7SG06|PPIH_NEUCR Peptidyl-prolyl cis-trans isomerase H OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cyp-3 PE=3 SV=1 811 965 1.0E-29
sp|Q6CL78|PPID_KLULA Peptidyl-prolyl cis-trans isomerase D OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CPR6 PE=3 SV=1 811 970 1.0E-29
sp|P53691|PPID_YEAST Peptidyl-prolyl cis-trans isomerase CPR6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CPR6 PE=1 SV=1 811 965 1.0E-29
sp|Q9CR16|PPID_MOUSE Peptidyl-prolyl cis-trans isomerase D OS=Mus musculus GN=Ppid PE=1 SV=3 811 959 1.0E-29
sp|Q5U8Z7|PPID_AMAMU Peptidyl-prolyl cis-trans isomerase D OS=Amanita muscaria GN=Cyp40 PE=2 SV=1 811 951 1.0E-29
sp|Q9UNP9|PPIE_HUMAN Peptidyl-prolyl cis-trans isomerase E OS=Homo sapiens GN=PPIE PE=1 SV=1 811 968 2.0E-29
sp|P34790|CP18C_ARATH Peptidyl-prolyl cis-trans isomerase CYP18-3 OS=Arabidopsis thaliana GN=CYP18-3 PE=1 SV=1 811 968 2.0E-29
sp|Q6DGG0|PPID_RAT Peptidyl-prolyl cis-trans isomerase D OS=Rattus norvegicus GN=Ppid PE=1 SV=3 811 959 2.0E-29
sp|Q5R723|PPIE_PONAB Peptidyl-prolyl cis-trans isomerase E OS=Pongo abelii GN=PPIE PE=2 SV=1 811 968 2.0E-29
sp|P10111|PPIA_RAT Peptidyl-prolyl cis-trans isomerase A OS=Rattus norvegicus GN=Ppia PE=1 SV=2 811 965 2.0E-29
sp|Q8HXS3|PPIA_FELCA Peptidyl-prolyl cis-trans isomerase A OS=Felis catus GN=PPIA PE=2 SV=3 811 967 2.0E-29
sp|P21569|CYPH_MAIZE Peptidyl-prolyl cis-trans isomerase OS=Zea mays GN=CYP PE=2 SV=1 811 968 2.0E-29
sp|P0CP78|PPIB_CRYNJ Peptidyl-prolyl cis-trans isomerase B OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CPR2 PE=3 SV=1 811 965 2.0E-29
sp|P0CP79|PPIB_CRYNB Peptidyl-prolyl cis-trans isomerase B OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CPR2 PE=3 SV=1 811 965 2.0E-29
sp|P54985|PPIA_BLAGE Peptidyl-prolyl cis-trans isomerase OS=Blattella germanica GN=CYPA PE=2 SV=1 811 968 2.0E-29
sp|Q8W171|CYP1_SOYBN Peptidyl-prolyl cis-trans isomerase 1 OS=Glycine max GN=Cyp1 PE=2 SV=1 811 968 3.0E-29
sp|P30404|PPIF_BOVIN Peptidyl-prolyl cis-trans isomerase F, mitochondrial OS=Bos taurus GN=PPIF PE=1 SV=3 811 968 3.0E-29
sp|Q6BXZ7|PPID_DEBHA Peptidyl-prolyl cis-trans isomerase D OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CPR6 PE=3 SV=1 811 962 3.0E-29
sp|Q4P6X6|PPIH_USTMA Peptidyl-prolyl cis-trans isomerase H (Fragment) OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CYP3 PE=3 SV=2 808 965 3.0E-29
sp|Q38900|CP19A_ARATH Peptidyl-prolyl cis-trans isomerase CYP19-1 OS=Arabidopsis thaliana GN=CYP19-1 PE=1 SV=1 811 952 3.0E-29
sp|Q9C566|CYP40_ARATH Peptidyl-prolyl cis-trans isomerase CYP40 OS=Arabidopsis thaliana GN=CYP40 PE=2 SV=1 811 965 4.0E-29
sp|P14851|PPIA_CRIGR Peptidyl-prolyl cis-trans isomerase A OS=Cricetulus griseus GN=PPIA PE=2 SV=2 811 965 5.0E-29
sp|Q8LDP4|CP19D_ARATH Peptidyl-prolyl cis-trans isomerase CYP19-4 OS=Arabidopsis thaliana GN=CYP19-4 PE=1 SV=2 789 950 5.0E-29
sp|P29117|PPIF_RAT Peptidyl-prolyl cis-trans isomerase F, mitochondrial OS=Rattus norvegicus GN=Ppif PE=1 SV=2 811 968 6.0E-29
sp|P17742|PPIA_MOUSE Peptidyl-prolyl cis-trans isomerase A OS=Mus musculus GN=Ppia PE=1 SV=2 811 965 7.0E-29
sp|Q99KR7|PPIF_MOUSE Peptidyl-prolyl cis-trans isomerase F, mitochondrial OS=Mus musculus GN=Ppif PE=1 SV=1 811 968 7.0E-29
sp|P21568|CYPH_SOLLC Peptidyl-prolyl cis-trans isomerase OS=Solanum lycopersicum GN=CYP PE=2 SV=1 811 952 7.0E-29
sp|A4FV72|PPIE_BOVIN Peptidyl-prolyl cis-trans isomerase E OS=Bos taurus GN=PPIE PE=2 SV=1 811 965 7.0E-29
sp|O00060|CYPH_UROFA Peptidyl-prolyl cis-trans isomerase OS=Uromyces fabae GN=PIG28 PE=2 SV=1 811 965 1.0E-28
sp|P35176|CYPD_YEAST Peptidyl-prolyl cis-trans isomerase D OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CPR5 PE=2 SV=1 811 966 1.0E-28
sp|O74729|PPIH_SCHPO Peptidyl-prolyl cis-trans isomerase cyp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cyp3 PE=3 SV=1 802 966 1.0E-28
sp|Q9UA41|PPID_DICDI Peptidyl-prolyl cis-trans isomerase D, mitochondrial OS=Dictyostelium discoideum GN=cypD PE=1 SV=1 808 954 1.0E-28
sp|Q4P555|PPIL2_USTMA Peptidyl-prolyl cis-trans isomerase-like 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CYP8 PE=3 SV=1 792 971 1.0E-28
sp|B3A0R0|PPI_LOTGI Putative peptidyl-prolyl cis-trans isomerase OS=Lottia gigantea PE=1 SV=1 789 965 2.0E-28
sp|P26882|PPID_BOVIN Peptidyl-prolyl cis-trans isomerase D OS=Bos taurus GN=PPID PE=1 SV=6 811 959 2.0E-28
sp|Q42406|CP18D_ARATH Peptidyl-prolyl cis-trans isomerase CYP18-4 OS=Arabidopsis thaliana GN=CYP18-4 PE=1 SV=1 808 967 2.0E-28
sp|P25007|PPIA_DROME Peptidyl-prolyl cis-trans isomerase OS=Drosophila melanogaster GN=Cyp1 PE=1 SV=2 811 967 2.0E-28
sp|Q4IPB8|PPIL3_GIBZE Peptidyl-prolyl cis-trans isomerase-like 3 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CYP10 PE=3 SV=2 806 970 2.0E-28
sp|P52018|CYP11_CAEEL Peptidyl-prolyl cis-trans isomerase 11 OS=Caenorhabditis elegans GN=cyn-11 PE=2 SV=1 811 966 2.0E-28
sp|P30405|PPIF_HUMAN Peptidyl-prolyl cis-trans isomerase F, mitochondrial OS=Homo sapiens GN=PPIF PE=1 SV=1 811 968 2.0E-28
sp|Q26551|PPIB_SCHMA Peptidyl-prolyl cis-trans isomerase B OS=Schistosoma mansoni GN=CYP PE=2 SV=1 813 965 2.0E-28
sp|O43447|PPIH_HUMAN Peptidyl-prolyl cis-trans isomerase H OS=Homo sapiens GN=PPIH PE=1 SV=1 802 954 3.0E-28
sp|Q0P5D0|PPIH_BOVIN Peptidyl-prolyl cis-trans isomerase H OS=Bos taurus GN=PPIH PE=2 SV=1 802 954 3.0E-28
sp|P23285|CYPB_YEAST Peptidyl-prolyl cis-trans isomerase B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CPR2 PE=1 SV=1 811 965 3.0E-28
sp|Q06118|PPIA_STRAQ Peptidyl-prolyl cis-trans isomerase A OS=Streptomyces anulatus GN=ppiA PE=1 SV=1 811 937 3.0E-28
sp|Q27450|CYP1_BRUMA Peptidyl-prolyl cis-trans isomerase 1 OS=Brugia malayi GN=CYP-1 PE=1 SV=1 811 968 4.0E-28
sp|Q13356|PPIL2_HUMAN Peptidyl-prolyl cis-trans isomerase-like 2 OS=Homo sapiens GN=PPIL2 PE=1 SV=1 806 965 5.0E-28
sp|P0CP82|PPIH_CRYNJ Peptidyl-prolyl cis-trans isomerase H OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CYP3 PE=3 SV=1 802 965 5.0E-28
sp|P0CP83|PPIH_CRYNB Peptidyl-prolyl cis-trans isomerase H OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CYP3 PE=3 SV=1 802 965 5.0E-28
sp|Q5ACI8|PPID_CANAL Peptidyl-prolyl cis-trans isomerase D OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CPR6 PE=3 SV=2 811 968 5.0E-28
sp|Q08752|PPID_HUMAN Peptidyl-prolyl cis-trans isomerase D OS=Homo sapiens GN=PPID PE=1 SV=3 811 959 5.0E-28
sp|Q9SP02|CP20A_ARATH Peptidyl-prolyl cis-trans isomerase CYP20-1 OS=Arabidopsis thaliana GN=CYP20-1 PE=1 SV=1 811 967 7.0E-28
sp|Q9D787|PPIL2_MOUSE Peptidyl-prolyl cis-trans isomerase-like 2 OS=Mus musculus GN=Ppil2 PE=1 SV=2 806 970 8.0E-28
sp|P30414|NKTR_HUMAN NK-tumor recognition protein OS=Homo sapiens GN=NKTR PE=1 SV=2 805 970 8.0E-28
sp|Q4R713|CWC27_MACFA Peptidyl-prolyl cis-trans isomerase CWC27 homolog OS=Macaca fascicularis GN=CWC27 PE=2 SV=1 805 940 8.0E-28
sp|Q54SM3|PPIA_DICDI Peptidyl-prolyl cis-trans isomerase A OS=Dictyostelium discoideum GN=ppiA PE=1 SV=1 811 967 1.0E-27
sp|Q6UX04|CWC27_HUMAN Peptidyl-prolyl cis-trans isomerase CWC27 homolog OS=Homo sapiens GN=CWC27 PE=1 SV=1 805 940 1.0E-27
sp|P30415|NKTR_MOUSE NK-tumor recognition protein OS=Mus musculus GN=Nktr PE=1 SV=4 805 970 1.0E-27
sp|Q5R7W3|CWC27_PONAB Peptidyl-prolyl cis-trans isomerase CWC27 homolog OS=Pongo abelii GN=CWC27 PE=2 SV=1 805 940 1.0E-27
sp|Q9LY75|CYP63_ARATH Peptidyl-prolyl cis-trans isomerase CYP63 OS=Arabidopsis thaliana GN=CYP63 PE=1 SV=1 813 971 2.0E-27
sp|O49886|CYPH_LUPLU Peptidyl-prolyl cis-trans isomerase OS=Lupinus luteus PE=2 SV=1 802 968 2.0E-27
sp|P84343|PPIA_NEOCA Peptidyl-prolyl cis-trans isomerase OS=Neospora caninum PE=1 SV=1 811 968 5.0E-27
sp|Q09637|CYP9_CAEEL Peptidyl-prolyl cis-trans isomerase 9 OS=Caenorhabditis elegans GN=cyn-9 PE=2 SV=3 811 952 5.0E-27
sp|P52010|CYP2_CAEEL Peptidyl-prolyl cis-trans isomerase 2 OS=Caenorhabditis elegans GN=cyn-2 PE=2 SV=2 811 951 5.0E-27
sp|Q8L8W5|CP21B_ARATH Peptidyl-prolyl cis-trans isomerase CYP21-2 OS=Arabidopsis thaliana GN=CYP21-2 PE=2 SV=1 811 950 7.0E-27
sp|Q9D868|PPIH_MOUSE Peptidyl-prolyl cis-trans isomerase H OS=Mus musculus GN=Ppih PE=1 SV=1 811 950 8.0E-27
sp|Q7RXA6|PPIL2_NEUCR Peptidyl-prolyl cis-trans isomerase-like 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ppi-2 PE=3 SV=1 806 954 9.0E-27
sp|A8X8D0|CYP9_CAEBR Peptidyl-prolyl cis-trans isomerase 9 OS=Caenorhabditis briggsae GN=cyn-9 PE=2 SV=2 811 967 1.0E-26
sp|Q8WUA2|PPIL4_HUMAN Peptidyl-prolyl cis-trans isomerase-like 4 OS=Homo sapiens GN=PPIL4 PE=1 SV=1 803 965 4.0E-26
sp|Q9V3G3|PPIE_DROME Peptidyl-prolyl cis-trans isomerase E OS=Drosophila melanogaster GN=cyp33 PE=1 SV=1 811 965 4.0E-26
sp|O55035|PPIG_RAT Peptidyl-prolyl cis-trans isomerase G OS=Rattus norvegicus GN=Ppig PE=1 SV=2 804 954 7.0E-26
sp|Q9CXG3|PPIL4_MOUSE Peptidyl-prolyl cis-trans isomerase-like 4 OS=Mus musculus GN=Ppil4 PE=1 SV=2 803 965 8.0E-26
sp|Q13427|PPIG_HUMAN Peptidyl-prolyl cis-trans isomerase G OS=Homo sapiens GN=PPIG PE=1 SV=2 804 954 8.0E-26
sp|A2AR02|PPIG_MOUSE Peptidyl-prolyl cis-trans isomerase G OS=Mus musculus GN=Ppig PE=1 SV=1 804 954 8.0E-26
sp|P0C1J2|CWC27_RHIO9 Peptidyl-prolyl isomerase cwc27 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cwc27 PE=3 SV=1 804 939 1.0E-25
sp|Q6MWS8|PPIL3_NEUCR Peptidyl-prolyl cis-trans isomerase-like 3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cyp-10 PE=3 SV=1 803 970 1.0E-25
sp|P10255|CYPH_NEUCR Peptidyl-prolyl cis-trans isomerase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=csr-1 PE=1 SV=1 772 937 1.0E-25
sp|P0C1I3|PPIH_RHIO9 Peptidyl-prolyl cis-trans isomerase H OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp7 PE=3 SV=1 811 965 3.0E-25
sp|P0DN37|PAL4G_HUMAN Peptidyl-prolyl cis-trans isomerase A-like 4G OS=Homo sapiens GN=PPIAL4G PE=3 SV=1 811 967 4.0E-25
sp|A0A0B4J2A2|PAL4C_HUMAN Peptidyl-prolyl cis-trans isomerase A-like 4C OS=Homo sapiens GN=PPIAL4C PE=2 SV=1 811 968 5.0E-25
sp|P0C1I9|CYP11_RHIO9 Peptidyl-prolyl cis-trans isomerase cyp11 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp11 PE=3 SV=1 811 951 1.0E-24
sp|Q8SRE1|CYPH_ENCCU Peptidyl-prolyl cis-trans isomerase OS=Encephalitozoon cuniculi (strain GB-M1) GN=CPR1 PE=1 SV=1 811 949 1.0E-24
sp|P0DN26|PAL4F_HUMAN Peptidyl-prolyl cis-trans isomerase A-like 4F OS=Homo sapiens GN=PPIAL4F PE=3 SV=1 811 968 2.0E-24
sp|A0A075B759|PAL4E_HUMAN Peptidyl-prolyl cis-trans isomerase A-like 4E OS=Homo sapiens GN=PPIAL4E PE=3 SV=1 811 968 2.0E-24
sp|Q9ZVJ4|CYP22_ARATH Peptidyl-prolyl cis-trans isomerase CYP22 OS=Arabidopsis thaliana GN=CYP22 PE=2 SV=1 811 952 2.0E-24
sp|P15425|CYPR_DROME Peptidyl-prolyl cis-trans isomerase, rhodopsin-specific isozyme OS=Drosophila melanogaster GN=ninaA PE=1 SV=1 785 967 2.0E-24
sp|P28517|CYPR_CALVI Peptidyl-prolyl cis-trans isomerase, rhodopsin-specific isozyme OS=Calliphora vicina GN=NINAA PE=2 SV=1 785 967 2.0E-24
sp|F5H284|PAL4D_HUMAN Peptidyl-prolyl cis-trans isomerase A-like 4D OS=Homo sapiens GN=PPIAL4D PE=3 SV=1 811 968 3.0E-24
sp|Q9Y536|PAL4A_HUMAN Peptidyl-prolyl cis-trans isomerase A-like 4A OS=Homo sapiens GN=PPIAL4A PE=2 SV=1 811 967 4.0E-24
sp|Q9ZJH5|PPIA_HELPJ Peptidyl-prolyl cis-trans isomerase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=ppiA PE=3 SV=1 792 950 4.0E-23
sp|Q6Q151|CYP59_ARATH Peptidyl-prolyl cis-trans isomerase CYP59 OS=Arabidopsis thaliana GN=CYP59 PE=1 SV=1 803 970 3.0E-22
sp|P0CP92|CWC27_CRYNJ Peptidyl-prolyl isomerase CWC27 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CWC27 PE=3 SV=1 805 958 6.0E-22
sp|P0CP93|CWC27_CRYNB Peptidyl-prolyl isomerase CWC27 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CWC27 PE=3 SV=1 805 958 6.0E-22
sp|H2QII6|RBP2_PANTR E3 SUMO-protein ligase RanBP2 OS=Pan troglodytes GN=RANBP2 PE=1 SV=1 811 951 8.0E-22
sp|Q6GLX7|CWC27_XENLA Peptidyl-prolyl cis-trans isomerase CWC27 homolog OS=Xenopus laevis GN=cwc27 PE=2 SV=1 805 940 9.0E-22
sp|O49605|CP21A_ARATH Peptidyl-prolyl cis-trans isomerase CYP21-1 OS=Arabidopsis thaliana GN=CYP21-1 PE=2 SV=1 811 967 1.0E-21
sp|Q7ZW86|CWC27_DANRE Peptidyl-prolyl cis-trans isomerase CWC27 homolog OS=Danio rerio GN=cwc27 PE=2 SV=1 805 940 4.0E-21
sp|Q3TKY6|CWC27_MOUSE Peptidyl-prolyl cis-trans isomerase CWC27 homolog OS=Mus musculus GN=Cwc27 PE=1 SV=1 805 940 5.0E-21
sp|P9WHW3|PPIA_MYCTU Peptidyl-prolyl cis-trans isomerase A OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppiA PE=1 SV=1 804 971 6.0E-21
sp|P9WHW2|PPIA_MYCTO Peptidyl-prolyl cis-trans isomerase A OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppiA PE=3 SV=1 804 971 6.0E-21
sp|P65763|PPIA_MYCBO Probable peptidyl-prolyl cis-trans isomerase A OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppiA PE=3 SV=1 804 971 6.0E-21
sp|P49792|RBP2_HUMAN E3 SUMO-protein ligase RanBP2 OS=Homo sapiens GN=RANBP2 PE=1 SV=2 811 951 7.0E-21
sp|Q17QX9|CWC27_BOVIN Peptidyl-prolyl cis-trans isomerase CWC27 homolog OS=Bos taurus GN=CWC27 PE=2 SV=1 805 940 1.0E-20
sp|Q5XIB2|CWC27_RAT Peptidyl-prolyl cis-trans isomerase CWC27 homolog OS=Rattus norvegicus GN=Cwc27 PE=1 SV=1 805 940 1.0E-20
sp|Q9CDE9|PPIA_MYCLE Probable peptidyl-prolyl cis-trans isomerase A OS=Mycobacterium leprae (strain TN) GN=ppiA PE=3 SV=1 804 971 2.0E-20
sp|Q1RMP7|PPIL6_BOVIN Peptidyl-prolyl cis-trans isomerase-like 6 OS=Bos taurus GN=PPIL6 PE=2 SV=1 811 965 2.0E-20
sp|P48820|RBP2_BOVIN E3 SUMO-protein ligase RanBP2 (Fragment) OS=Bos taurus GN=RANBP2 PE=2 SV=2 811 951 2.0E-20
sp|Q9ERU9|RBP2_MOUSE E3 SUMO-protein ligase RanBP2 OS=Mus musculus GN=Ranbp2 PE=1 SV=2 811 951 2.0E-20
sp|O42941|CYP7_SCHPO Peptidylprolyl isomerase cyp7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cyp7 PE=1 SV=1 803 939 4.0E-20
sp|Q8IXY8|PPIL6_HUMAN Peptidyl-prolyl cis-trans isomerase-like 6 OS=Homo sapiens GN=PPIL6 PE=2 SV=1 802 967 5.0E-20
sp|Q7SBX8|CWC27_NEUCR Peptidyl-prolyl isomerase cwc-27 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cwc-27 PE=3 SV=1 803 938 7.0E-20
sp|P0CP88|PPIL4_CRYNJ Peptidyl-prolyl cis-trans isomerase-like 4 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CYP6 PE=3 SV=1 803 970 1.0E-19
sp|P0CP89|PPIL4_CRYNB Peptidyl-prolyl cis-trans isomerase-like 4 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CYP6 PE=3 SV=1 803 970 1.0E-19
sp|Q4WE62|CWC27_ASPFU Peptidyl-prolyl isomerase cwc27 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cwc27 PE=3 SV=1 803 970 2.0E-19
sp|Q5BAH7|PPIL3_EMENI Peptidyl-prolyl cis-trans isomerase-like 3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cyp10 PE=3 SV=2 806 962 3.0E-19
sp|O25982|PPIA_HELPY Peptidyl-prolyl cis-trans isomerase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=ppiA PE=3 SV=1 792 950 6.0E-19
sp|Q4P7H2|CWC27_USTMA Peptidyl-prolyl isomerase CWC27 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CWC27 PE=3 SV=1 806 970 6.0E-19
sp|P44499|PPIB_HAEIN Peptidyl-prolyl cis-trans isomerase B OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ppiB PE=3 SV=1 806 970 7.0E-19
sp|Q5AUG9|CWC27_EMENI Peptidyl-prolyl isomerase cwc27 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cwc27 PE=3 SV=1 803 970 2.0E-18
sp|Q4IPB3|CWC27_GIBZE Peptidyl-prolyl isomerase CWC27 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CWC27 PE=3 SV=1 805 970 2.0E-18
sp|P42693|PPIA_ACIAD Peptidyl-prolyl cis-trans isomerase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=rotA PE=3 SV=1 806 970 2.0E-17
sp|Q4WAQ9|PPIL4_ASPFU Peptidyl-prolyl cis-trans isomerase-like 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cyp6 PE=3 SV=1 803 965 2.0E-17
sp|P0C1I6|PPIL4_RHIO9 Peptidyl-prolyl cis-trans isomerase-like 4 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp13 PE=3 SV=1 803 965 3.0E-17
sp|Q4WMB6|PPIL3_ASPFU Peptidyl-prolyl cis-trans isomerase-like 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cyp10 PE=3 SV=2 806 953 5.0E-17
sp|Q5ARI5|PPIL4_EMENI Peptidyl-prolyl cis-trans isomerase-like 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cyp6 PE=3 SV=1 803 965 2.0E-16
sp|Q871A4|PPIL4_NEUCR Peptidyl-prolyl cis-trans isomerase-like 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cyp-6 PE=3 SV=1 803 965 3.0E-16
sp|P47103|CYP7_YEAST Peptidyl-prolyl cis-trans isomerase CYP7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CPR7 PE=1 SV=1 802 970 4.0E-16
sp|Q4IE79|PPIL4_GIBZE Peptidyl-prolyl cis-trans isomerase-like 4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CYP6 PE=3 SV=2 803 965 6.0E-16
sp|Q9UUE4|PPIL4_SCHPO Peptidyl-prolyl cis-trans isomerase cyp6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cyp6 PE=1 SV=1 803 965 7.0E-16
sp|P23869|PPIB_ECOLI Peptidyl-prolyl cis-trans isomerase B OS=Escherichia coli (strain K12) GN=ppiB PE=1 SV=2 806 971 1.0E-15
sp|P83221|PPIB_STRAT Peptidyl-prolyl cis-trans isomerase cyp18 OS=Streptomyces antibioticus GN=cyp18 PE=1 SV=3 806 965 2.0E-15
sp|P35137|PPIB_BACSU Peptidyl-prolyl cis-trans isomerase B OS=Bacillus subtilis (strain 168) GN=ppiB PE=1 SV=1 813 957 6.0E-15
sp|P0AFL3|PPIA_ECOLI Peptidyl-prolyl cis-trans isomerase A OS=Escherichia coli (strain K12) GN=ppiA PE=1 SV=1 805 963 3.0E-14
sp|P0AFL4|PPIA_ECOL6 Peptidyl-prolyl cis-trans isomerase A OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ppiA PE=3 SV=1 805 963 3.0E-14
sp|P0AFL5|PPIA_ECO57 Peptidyl-prolyl cis-trans isomerase A OS=Escherichia coli O157:H7 GN=ppiA PE=3 SV=1 805 963 3.0E-14
sp|Q2U256|PPIL4_ASPOR Peptidyl-prolyl cis-trans isomerase-like 4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cyp6 PE=3 SV=1 803 965 7.0E-14
sp|P29820|PPI_SYNE7 Peptidyl-prolyl cis-trans isomerase OS=Synechococcus elongatus (strain PCC 7942) GN=rot PE=3 SV=1 804 938 7.0E-14
sp|P20753|PPIA_SALTY Peptidyl-prolyl cis-trans isomerase A OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ppiA PE=3 SV=2 805 963 8.0E-14
sp|Q59641|PPIA_PSEAE Peptidyl-prolyl cis-trans isomerase A OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ppiA PE=3 SV=2 805 967 2.0E-13
sp|Q94A16|CP21C_ARATH Peptidyl-prolyl cis-trans isomerase CYP21-3, mitochondrial OS=Arabidopsis thaliana GN=CYP21-3 PE=2 SV=2 804 968 2.0E-13
sp|O53021|PPIA_DICD3 Peptidyl-prolyl cis-trans isomerase A OS=Dickeya dadantii (strain 3937) GN=rotA PE=3 SV=2 805 963 2.0E-13
sp|Q8G0J9|PPI1_BRUSU Probable peptidyl-prolyl cis-trans isomerase OS=Brucella suis biovar 1 (strain 1330) GN=ppi PE=3 SV=1 805 950 1.0E-12
sp|Q8YHB5|PPI1_BRUME Probable peptidyl-prolyl cis-trans isomerase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ppi PE=3 SV=2 805 950 1.0E-12
sp|P9WHW1|PPIB_MYCTU Probable peptidyl-prolyl cis-trans isomerase B OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppiB PE=1 SV=1 806 903 1.0E-12
sp|P9WHW0|PPIB_MYCTO Probable peptidyl-prolyl cis-trans isomerase B OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppiB PE=3 SV=1 806 903 1.0E-12
sp|Q8RWY7|CYP95_ARATH Peptidyl-prolyl cis-trans isomerase CYP95 OS=Arabidopsis thaliana GN=CYP95 PE=1 SV=2 817 968 2.0E-12
sp|Q57D43|PPI1_BRUAB Probable peptidyl-prolyl cis-trans isomerase OS=Brucella abortus biovar 1 (strain 9-941) GN=ppi PE=3 SV=1 805 950 3.0E-12
sp|Q2YPY5|PPI1_BRUA2 Probable peptidyl-prolyl cis-trans isomerase OS=Brucella abortus (strain 2308) GN=ppi PE=3 SV=1 805 950 3.0E-12
sp|P72704|PPI1_SYNY3 Probable peptidyl-prolyl cis-trans isomerase sll0227 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0227 PE=3 SV=1 813 950 7.0E-12
sp|P0C196|PPIL4_USTMA Peptidyl-prolyl cis-trans isomerase-like 4 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CYP6 PE=3 SV=1 803 968 1.0E-11
sp|P46697|PPIB_MYCLE Probable peptidyl-prolyl cis-trans isomerase B OS=Mycobacterium leprae (strain TN) GN=ppiB PE=3 SV=1 803 903 4.0E-11
sp|Q8LDR3|CYP23_ARATH Peptidyl-prolyl cis-trans isomerase CYP23 OS=Arabidopsis thaliana GN=CYP23 PE=2 SV=1 804 967 6.0E-11
sp|Q55DA2|CIAO1_DICDI Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Dictyostelium discoideum GN=ciao1 PE=3 SV=1 387 583 3.0E-09
sp|Q28I85|POC1A_XENTR POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1 399 629 4.0E-08
sp|P25334|CYPR_YEAST Peptidyl-prolyl cis-trans isomerase CPR4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CPR4 PE=3 SV=1 811 966 7.0E-08
sp|Q7T0P4|POC1A_XENLA POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2 386 629 1.0E-07
sp|Q9D6D8|PPIL6_MOUSE Peptidyl-prolyl cis-trans isomerase-like 6 OS=Mus musculus GN=Ppil6 PE=1 SV=1 811 890 5.0E-07
sp|Q7ZVF0|POC1A_DANRE POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1 392 629 3.0E-06
sp|A8X8C6|TG125_CAEBR WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 403 633 6.0E-06
sp|Q86VZ2|WDR5B_HUMAN WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 391 633 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0000413 protein peptidyl-prolyl isomerization Yes
GO:0003755 peptidyl-prolyl cis-trans isomerase activity Yes
GO:0043412 macromolecule modification No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0018193 peptidyl-amino acid modification No
GO:0140096 catalytic activity, acting on a protein No
GO:0043170 macromolecule metabolic process No
GO:0019538 protein metabolic process No
GO:0016853 isomerase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0016859 cis-trans isomerase activity No
GO:0036211 protein modification process No
GO:0003674 molecular_function No
GO:1901564 organonitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0018208 peptidyl-proline modification No
GO:0071704 organic substance metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 16 0.999697

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1638
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7360
Ophiocordyceps australis map64 (Brazil) OphauB2|2129
Ophiocordyceps camponoti-floridani Ophcf2|00354
Ophiocordyceps camponoti-rufipedis Ophun1|7223 (this protein)
Ophiocordyceps kimflemingae Ophio5|8138
Ophiocordyceps subramaniannii Hirsu2|1324

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7223
MLPSLLLLSLASLGAAAPVDEAKKAKAAASSLTDTDILNYALTLEYLERKFYTEGLKNYTSDDFIDAGFDRKLYD
NLVRVREDEKSHVNFLSMALGSAAIAEPHFSFPVNNAHDFVTLASVLEGVGVSAYLGAAASIANKDYLTAAGSIL
SVEARHAAYLRSVVHEDPVPTSYDTPLSFNPVFSLAAGFTTFPPETKLPFKAFPPLAASSFHRDGKFCSGKSFVT
FKNINTPSNAKIFVVLYSGQQTYYVPATPLGPTAFRIKMPGESFAYPGEPAPAGQVYAILSTADGKESKASDDNT
LAGVAILEVSRFLNPQEDHRYHQSEAYNSNMAPSPNKDDTRSQKRSHAEFAAKDAQDSSSDDDDMGPKLPPSAPP
KKRRVLPYEKLYVEAMPKSGNYSRSLMHKEQLLFVTWTPLTDFLVTASVDGVVKFWKKMARGIEFVKQFQTHSGE
IKSVSVSQDGRSYATAGADGIVTIFDVVTFDLLHVIPLGYMPACVCWVHRRGASIPLLAASEEDKPLIHLYDGRG
EVQEPISSIKKMHKSPVHLMAFNDAFDCVVSADGLGMVEYWRPSGSYDKPENVFEYKSATNLYDFRKAKSVPSCL
SISPNGKSLVTFSLPDRKIRLFDFATGKLHRTYDESLQAIQEMQQASRKMDNVEFGRRLALEKEIETAPLLYKTN
VIFDESGNFILYGSMMGVKLLNTYTNQVLKVYGKDESMRAVNLALYQGQPQKKGVVSIEMGASKNPLLQESEARD
PILVATGVGKVRFFMFTDEGEVSKSTRDIQNEKPVNSGAKKEVKERKKERAEAAILRTTYGDIHIRLFPDAAPKS
VENFVTHAKNGYYNNTIFHRVIRKFMIQGGDPMGDGTGGESIWNREFEDEFSSLKHDKPFTVSMANAGPNTNGSQ
FFITTEKTVGRWMTRLSMLVADFCSQPWLDGKHTIFGRATQGFDVINKIENVRTFKEKPEEDIKIVNIDVT*
Coding >Ophun1|7223
ATGCTTCCATCTCTCCTCCTCCTCTCCCTTGCCTCTCTGGGCGCCGCTGCGCCTGTCGATGAAGCCAAGAAGGCG
AAAGCGGCCGCTTCCTCGCTGACAGACACCGACATCCTCAACTATGCCCTGACGCTCGAGTATCTGGAGCGCAAG
TTCTATACAGAAGGCTTGAAGAACTACACCTCGGACGACTTTATCGACGCTGGCTTCGATCGTAAGCTGTACGAC
AACCTCGTCCGGGTGCGCGAGGATGAAAAGTCGCATGTCAATTTCCTGTCTATGGCTCTCGGCAGTGCAGCCATC
GCTGAGCCTCACTTCTCATTCCCCGTCAACAACGCCCACGACTTCGTAACCCTTGCCAGTGTCCTCGAGGGCGTT
GGCGTCTCGGCCTATCTGGGAGCCGCTGCCTCCATTGCCAACAAGGACTATCTGACGGCTGCGGGCTCCATTCTT
TCGGTCGAGGCCCGGCACGCGGCGTACTTGCGGTCTGTCGTGCACGAGGATCCGGTCCCGACGTCGTACGACACG
CCTCTCAGCTTCAACCCGGTCTTTTCTCTCGCCGCTGGCTTCACCACCTTTCCTCCTGAAACCAAGCTTCCCTTC
AAGGCGTTCCCCCCCCTCGCTGCCTCTTCTTTCCACCGCGACGGCAAGTTTTGCTCCGGAAAGAGCTTCGTCACC
TTCAAGAACATCAACACGCCCAGCAACGCCAAGATCTTTGTCGTCCTTTACTCCGGTCAGCAGACGTACTATGTT
CCCGCCACGCCCTTGGGGCCAACAGCGTTCAGGATAAAGATGCCGGGAGAGAGCTTCGCCTACCCTGGTGAGCCG
GCGCCCGCGGGACAGGTTTATGCCATTCTCAGCACGGCTGATGGCAAGGAGAGCAAGGCGAGTGATGATAATACC
CTGGCTGGAGTTGCCATTCTCGAGGTTTCGCGGTTCCTGAATCCGCAAGAGGACCATCGCTATCATCAGAGCGAG
GCTTATAACAGCAATATGGCGCCTTCACCCAATAAAGACGATACCCGCTCGCAGAAACGCAGCCACGCCGAATTT
GCAGCCAAAGATGCACAAGACTCCTCTTCAGACGACGATGACATGGGCCCTAAGCTGCCCCCGTCAGCGCCCCCG
AAGAAGCGCCGTGTCCTGCCCTACGAGAAGCTCTATGTCGAAGCCATGCCCAAATCGGGCAACTATTCGCGCTCG
CTGATGCACAAGGAGCAGTTGCTCTTTGTCACCTGGACGCCGTTGACCGATTTCCTCGTCACCGCCTCTGTCGAT
GGCGTTGTCAAGTTCTGGAAGAAGATGGCCCGGGGCATCGAGTTTGTCAAGCAGTTCCAAACTCACAGCGGCGAG
ATCAAGTCCGTCTCTGTCAGCCAGGATGGCAGGAGTTATGCCACCGCCGGAGCCGACGGGATAGTCACCATCTTC
GACGTCGTCACCTTCGATCTGTTGCACGTTATTCCCTTGGGCTATATGCCCGCCTGTGTCTGCTGGGTTCATCGG
AGGGGTGCTTCGATCCCGCTGCTCGCTGCCTCGGAGGAGGACAAGCCGTTGATACACCTCTACGATGGCCGGGGT
GAGGTTCAGGAGCCCATAAGCTCCATCAAGAAAATGCACAAGAGTCCGGTTCACCTGATGGCCTTCAACGACGCC
TTCGACTGCGTTGTTTCGGCGGATGGCCTGGGCATGGTCGAGTACTGGCGACCCAGTGGCAGCTACGACAAGCCC
GAAAACGTCTTCGAATACAAGAGCGCCACCAACTTGTACGACTTCCGCAAGGCCAAGAGCGTGCCATCTTGTCTG
TCCATCTCGCCCAATGGCAAGAGTCTCGTCACCTTTTCCTTGCCAGACCGCAAGATACGACTGTTCGACTTTGCC
ACGGGCAAGCTGCACCGCACATACGACGAGTCACTCCAGGCGATACAGGAGATGCAGCAGGCTTCGCGCAAGATG
GACAATGTCGAGTTCGGACGCCGTCTCGCACTCGAAAAGGAGATTGAGACTGCACCGCTGCTTTACAAGACCAAC
GTCATCTTTGACGAGTCGGGCAACTTCATTCTCTACGGCTCTATGATGGGTGTCAAGCTCCTCAACACGTATACG
AATCAGGTGCTGAAGGTGTACGGTAAGGACGAGAGCATGCGCGCCGTCAACCTGGCTCTCTACCAGGGTCAGCCG
CAGAAGAAGGGCGTCGTCTCCATCGAGATGGGCGCGTCCAAAAACCCCCTTCTTCAGGAATCCGAGGCCAGAGAC
CCGATCCTGGTTGCCACAGGAGTGGGCAAGGTGCGCTTCTTCATGTTTACTGATGAAGGGGAAGTGTCCAAATCG
ACGCGTGACATCCAAAACGAAAAGCCCGTCAACTCTGGCGCAAAGAAAGAGGTCAAGGAGAGGAAGAAGGAGAGG
GCCGAGGCCGCCATCCTCCGAACCACGTACGGCGACATCCATATACGCCTCTTTCCCGATGCCGCGCCCAAGTCG
GTTGAGAATTTCGTCACGCACGCCAAGAACGGCTACTACAACAACACCATCTTCCACAGAGTCATCCGCAAGTTC
ATGATCCAGGGCGGCGACCCGATGGGCGACGGGACCGGCGGCGAGAGCATCTGGAACAGGGAGTTTGAGGACGAG
TTCAGCAGCCTCAAACACGACAAGCCCTTCACCGTGAGCATGGCCAACGCGGGTCCCAACACCAACGGGAGTCAG
TTCTTCATCACGACGGAGAAGACGGTAGGTCGCTGGATGACGCGTTTATCGATGCTCGTGGCTGATTTCTGCTCG
CAGCCTTGGCTTGATGGCAAGCACACGATATTCGGACGCGCAACGCAGGGATTCGACGTCATCAACAAGATTGAG
AACGTGCGAACTTTCAAGGAGAAGCCCGAGGAGGACATAAAGATTGTCAACATTGATGTTACATAG
Transcript >Ophun1|7223
ATGCTTCCATCTCTCCTCCTCCTCTCCCTTGCCTCTCTGGGCGCCGCTGCGCCTGTCGATGAAGCCAAGAAGGCG
AAAGCGGCCGCTTCCTCGCTGACAGACACCGACATCCTCAACTATGCCCTGACGCTCGAGTATCTGGAGCGCAAG
TTCTATACAGAAGGCTTGAAGAACTACACCTCGGACGACTTTATCGACGCTGGCTTCGATCGTAAGCTGTACGAC
AACCTCGTCCGGGTGCGCGAGGATGAAAAGTCGCATGTCAATTTCCTGTCTATGGCTCTCGGCAGTGCAGCCATC
GCTGAGCCTCACTTCTCATTCCCCGTCAACAACGCCCACGACTTCGTAACCCTTGCCAGTGTCCTCGAGGGCGTT
GGCGTCTCGGCCTATCTGGGAGCCGCTGCCTCCATTGCCAACAAGGACTATCTGACGGCTGCGGGCTCCATTCTT
TCGGTCGAGGCCCGGCACGCGGCGTACTTGCGGTCTGTCGTGCACGAGGATCCGGTCCCGACGTCGTACGACACG
CCTCTCAGCTTCAACCCGGTCTTTTCTCTCGCCGCTGGCTTCACCACCTTTCCTCCTGAAACCAAGCTTCCCTTC
AAGGCGTTCCCCCCCCTCGCTGCCTCTTCTTTCCACCGCGACGGCAAGTTTTGCTCCGGAAAGAGCTTCGTCACC
TTCAAGAACATCAACACGCCCAGCAACGCCAAGATCTTTGTCGTCCTTTACTCCGGTCAGCAGACGTACTATGTT
CCCGCCACGCCCTTGGGGCCAACAGCGTTCAGGATAAAGATGCCGGGAGAGAGCTTCGCCTACCCTGGTGAGCCG
GCGCCCGCGGGACAGGTTTATGCCATTCTCAGCACGGCTGATGGCAAGGAGAGCAAGGCGAGTGATGATAATACC
CTGGCTGGAGTTGCCATTCTCGAGGTTTCGCGGTTCCTGAATCCGCAAGAGGACCATCGCTATCATCAGAGCGAG
GCTTATAACAGCAATATGGCGCCTTCACCCAATAAAGACGATACCCGCTCGCAGAAACGCAGCCACGCCGAATTT
GCAGCCAAAGATGCACAAGACTCCTCTTCAGACGACGATGACATGGGCCCTAAGCTGCCCCCGTCAGCGCCCCCG
AAGAAGCGCCGTGTCCTGCCCTACGAGAAGCTCTATGTCGAAGCCATGCCCAAATCGGGCAACTATTCGCGCTCG
CTGATGCACAAGGAGCAGTTGCTCTTTGTCACCTGGACGCCGTTGACCGATTTCCTCGTCACCGCCTCTGTCGAT
GGCGTTGTCAAGTTCTGGAAGAAGATGGCCCGGGGCATCGAGTTTGTCAAGCAGTTCCAAACTCACAGCGGCGAG
ATCAAGTCCGTCTCTGTCAGCCAGGATGGCAGGAGTTATGCCACCGCCGGAGCCGACGGGATAGTCACCATCTTC
GACGTCGTCACCTTCGATCTGTTGCACGTTATTCCCTTGGGCTATATGCCCGCCTGTGTCTGCTGGGTTCATCGG
AGGGGTGCTTCGATCCCGCTGCTCGCTGCCTCGGAGGAGGACAAGCCGTTGATACACCTCTACGATGGCCGGGGT
GAGGTTCAGGAGCCCATAAGCTCCATCAAGAAAATGCACAAGAGTCCGGTTCACCTGATGGCCTTCAACGACGCC
TTCGACTGCGTTGTTTCGGCGGATGGCCTGGGCATGGTCGAGTACTGGCGACCCAGTGGCAGCTACGACAAGCCC
GAAAACGTCTTCGAATACAAGAGCGCCACCAACTTGTACGACTTCCGCAAGGCCAAGAGCGTGCCATCTTGTCTG
TCCATCTCGCCCAATGGCAAGAGTCTCGTCACCTTTTCCTTGCCAGACCGCAAGATACGACTGTTCGACTTTGCC
ACGGGCAAGCTGCACCGCACATACGACGAGTCACTCCAGGCGATACAGGAGATGCAGCAGGCTTCGCGCAAGATG
GACAATGTCGAGTTCGGACGCCGTCTCGCACTCGAAAAGGAGATTGAGACTGCACCGCTGCTTTACAAGACCAAC
GTCATCTTTGACGAGTCGGGCAACTTCATTCTCTACGGCTCTATGATGGGTGTCAAGCTCCTCAACACGTATACG
AATCAGGTGCTGAAGGTGTACGGTAAGGACGAGAGCATGCGCGCCGTCAACCTGGCTCTCTACCAGGGTCAGCCG
CAGAAGAAGGGCGTCGTCTCCATCGAGATGGGCGCGTCCAAAAACCCCCTTCTTCAGGAATCCGAGGCCAGAGAC
CCGATCCTGGTTGCCACAGGAGTGGGCAAGGTGCGCTTCTTCATGTTTACTGATGAAGGGGAAGTGTCCAAATCG
ACGCGTGACATCCAAAACGAAAAGCCCGTCAACTCTGGCGCAAAGAAAGAGGTCAAGGAGAGGAAGAAGGAGAGG
GCCGAGGCCGCCATCCTCCGAACCACGTACGGCGACATCCATATACGCCTCTTTCCCGATGCCGCGCCCAAGTCG
GTTGAGAATTTCGTCACGCACGCCAAGAACGGCTACTACAACAACACCATCTTCCACAGAGTCATCCGCAAGTTC
ATGATCCAGGGCGGCGACCCGATGGGCGACGGGACCGGCGGCGAGAGCATCTGGAACAGGGAGTTTGAGGACGAG
TTCAGCAGCCTCAAACACGACAAGCCCTTCACCGTGAGCATGGCCAACGCGGGTCCCAACACCAACGGGAGTCAG
TTCTTCATCACGACGGAGAAGACGGTAGGTCGCTGGATGACGCGTTTATCGATGCTCGTGGCTGATTTCTGCTCG
CAGCCTTGGCTTGATGGCAAGCACACGATATTCGGACGCGCAACGCAGGGATTCGACGTCATCAACAAGATTGAG
AACGTGCGAACTTTCAAGGAGAAGCCCGAGGAGGACATAAAGATTGTCAACATTGATGTTACATAG
Gene >Ophun1|7223
ATGCTTCCATCTCTCCTCCTCCTCTCCCTTGCCTCTCTGGGCGCCGCTGCGCCTGTCGATGAAGCCAAGAAGGCG
AAAGCGGCCGCTTCCTCGCTGACAGACACCGACATCCTCAACTATGCCCTGACGCTCGAGTATCTGGAGCGCAAG
TTCTATACAGAAGGCTTGAAGAACTACACCTCGGACGACTTTATCGACGCTGGCTTCGATCGTAAGCTGTACGAC
AACCTCGTCCGGGTGCGCGAGGATGAAAAGGTAAGCACCACTCCATTCAGCGTCTTGTTCGCCATCGAGACTAAT
GACGAGTCTTCATCGCCCAGTCGCATGTCAATTTCCTGTCTATGGCTCTCGGCAGTGCAGCCATCGCTGAGCCTC
ACTTCTCATTCCCCGTCAACAACGCCCACGACTTCGTAACCCTTGCCAGTGTCCTCGAGGGCGTTGGCGTCTCGG
CCTATCTGGGAGCCGCTGCCTCCATTGCCAACAAGGACTATCTGACGGCTGCGGGCTCCATTCTTTCGGTCGAGG
CCCGGCACGCGGCGTACTTGCGGTCTGTCGTGCACGAGGATCCGGTCCCGACGTCGTACGACACGCCTCTCAGCT
TCAACCCGGTCTTTTCTCTCGCCGCTGGCTTCACCACCTTTCCTCCTGAAACCAAGCTTCCCTTCAAGGCGTTCC
CCCCCCTCGCTGCCTCTTCTTTCCACCGCGACGGCAAGTTTTGCTCCGGAAAGAGCTTCGTCACCTTCAAGAACA
TCAACACGCCCAGCAACGCCAAGATCTTTGTCGTCCTTTACTCCGGTCAGCAGACGTACTATGTTCCCGCCACGC
CCTTGGGGCCAACAGCGGTGAGTTTCGATCCGTCGCTCTCAAGACTTGGATGCCGCTGACGCTTCGGTTCAGTTC
AGGATAAAGATGCCGGGAGAGAGCTTCGCCTACCCTGGTGAGCCGGCGCCCGCGGGACAGGTTTATGCCATTCTC
AGCACGGCTGATGGCAAGGAGAGCAAGGCGAGTGATGATAATACCCTGGCTGGAGTTGCCATTCTCGAGGTTTCG
CGGTGTTAGTTGGGGGAAGGGCGTTGGATGGCAGATGTGCGGGCTACTTGGTGAAAACAAGTTAGACTTAGAACA
TGTAAGCGAATAGGAGTTTTTCGATTCTCATCTTTGATCTGCTGAGTCGTCAATGGAGTGAAGTCGGTAGTAGAT
CTCCGAAACGAAGTAAGAATAGTGCTGCGAATGATCCGCGTCTAGGGTAGGCAGAGTGTATTGATCGAAGCTCAT
GGATTACATCAGCATCTGCCAGCTCCTTTCTTCCATCATCGCAGCCAGAGACTCTGACGATGAAATCGATCCGGT
GCTGAAGCCACGAAAGTCCTGAATCCGCAAGAGGACCATCGCTATCATCAGAGCGAGGCTTATAACAGCAATATG
GCGCCTTCACCCAATAAAGACGATACCCGCTCGCAGAAACGCAGCCACGCCGAATTTGCAGCCAAAGATGCACAA
GGTTCCCTCCCTCCCTCTCTTCCATTCCCAGCTTCGCAAGCCGCTCACTGGTTCCCAAGACTCCTCTTCAGACGA
CGATGACATGGGCCCTAAGCTGCCCCCGTCAGCGCCCCCGAAGAAGCGCCGTGTCCTGCCCTACGAGAAGCTCTA
TGTCGAAGCCATGCCCAAATCGGGCAACTATTCGCGCTCGCTGATGCACAAGGAGCAGTTGCTCTTTGTCACCTG
GACGCCGTTGACCGATTTCCTCGTCACCGCCTCTGTCGATGGCGTTGTCAAGTTCTGGAAGAAGATGGCCCGGGG
CATCGAGTTTGTCAAGCAGTTCCAAACTCACAGCGGCGAGATCAAGTCCGTCTCTGTCAGCCAGGATGGCAGGAG
TTATGCCACCGCCGGAGCCGACGGGATAGTCACCATCTTCGACGTCGTCACCTTCGATCTGTTGCACGTTATTCC
CTTGGGCTATATGCCCGCCTGTGTCTGCTGGGTTCATCGGAGGGGTGCTTCGATCCCGCTGCTCGCTGCCTCGGA
GGAGGACAAGCCGTTGATACACCTCTACGATGGCCGGGGTGAGGTTCAGGAGCCCATAAGCTCCATCAAGAAAAT
GCACAAGAGTCCGGTTCACCTGATGGCCTTCAACGACGCCTTCGACTGCGTTGTTTCGGCGGATGGCCTGGGCAT
GGTCGAGTACTGGCGACCCAGTGGCAGCTACGACAAGCCCGAAAACGTCTTCGAATACAAGAGCGCCACCAACTT
GTACGACTTCCGCAAGGCCAAGAGCGTGCCATCTTGTCTGTCCATCTCGCCCAATGGCAAGAGTCTCGTCACCTT
TTCCTTGCCAGACCGCAAGATACGACTGTTCGACTTTGCCACGGGCAAGCTGCACCGCACATACGACGAGTCACT
CCAGGCGATACAGGAGATGCAGCAGGCTTCGCGCAAGATGGACAATGTCGAGTTCGGACGCCGTCTCGCACTCGA
AAAGGAGATTGAGACTGCACCGCTGCTTTACAAGACCAACGTCATCTTTGACGAGTCGGGCAACTTCATTCTCTA
CGGCTCTATGATGGGTGTCAAGCTCCTCAACACGTATACGAATCAGGTGCTGAAGGTGTACGGTAAGGACGAGAG
CATGCGCGCCGTCAACCTGGCTCTCTACCAGGGTCAGCCGCAGAAGAAGGGCGTCGTCTCCATCGAGATGGGCGC
GTCCAAAAACCCCCTTCTTCAGGAATCCGAGGCCAGAGACCCGATCCTGGTTGCCACAGGAGTGGGCAAGGTGCG
CTTCTTCATGTTTACTGATGAAGGGGAAGTGTCCAAATCGACGCGTGACATCCAAAACGAAAAGCCCGTCAACTC
TGGCGCAAAGAAAGAGGTCAAGGAGAGGAAGAAGGAGAGGGCCGAGGCCGCCATCCTCCGAACCACGTACGGCGA
CATCCATATACGCCTCTTTCCCGATGCCGCGCCCAAGTCGGTTGAGAATTTCGTCACGCACGCCAAGAACGGCTA
CTACAACAACACCATCTTCCACAGAGTCATCCGCAAGTTCATGATCCAGGGCGGCGACCCGATGGGCGACGGGAC
CGGCGGCGAGAGCATCTGGAACAGGGAGTTTGAGGACGAGTTCAGCAGCCTCAAACACGACAAGCCCTTCACCGT
GAGCATGGCCAACGCGGGTCCCAACACCAACGGGAGTCAGTTCTTCATCACGACGGAGAAGACGGTAGGTCGCTG
GATGACGCGTTTATCGATGCTCGTGGCTGATTTCTGCTCGCAGCCTTGGCTTGATGGCAAGCACACGATATTCGG
ACGCGCAACGCAGGGATTCGACGTCATCAACAAGATTGAGAACGTGCGAACTTTCAAGGAGAAGCCCGAGGAGGA
CATAAAGATTGTCAACATTGATGTTACATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail