Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7222
Gene name
LocationContig_88:17497..18298
Strand+
Gene length (bp)801
Transcript length (bp)801
Coding sequence length (bp)801
Protein length (aa) 267

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05572 Peptidase_M43 Pregnancy-associated plasma protein-A 3.8E-08 199 264

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|E3QJV4|MEP1_COLGM Extracellular metalloprotease GLRG_06286 OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=GLRG_06286 PE=3 SV=1 14 264 8.0E-38
sp|Q871C5|MEP1_NEUCR Extracellular metalloprotease NCU07200 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B8G12.220 PE=3 SV=1 19 266 4.0E-37
sp|A4RGT4|MEP1_MAGO7 Extracellular metalloprotease MGG_08041 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_08041 PE=3 SV=1 7 266 1.0E-34
sp|D1ZSU8|MEP1_SORMK Extracellular metalloprotease SMAC_06893 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=SMAC_06893 PE=3 SV=1 5 266 1.0E-34
sp|C9S5C6|MEP1_VERA1 Extracellular metalloprotease VDBG_01143 OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=VDBG_01143 PE=3 SV=1 3 266 5.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|E3QJV4|MEP1_COLGM Extracellular metalloprotease GLRG_06286 OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=GLRG_06286 PE=3 SV=1 14 264 8.0E-38
sp|Q871C5|MEP1_NEUCR Extracellular metalloprotease NCU07200 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B8G12.220 PE=3 SV=1 19 266 4.0E-37
sp|A4RGT4|MEP1_MAGO7 Extracellular metalloprotease MGG_08041 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_08041 PE=3 SV=1 7 266 1.0E-34
sp|D1ZSU8|MEP1_SORMK Extracellular metalloprotease SMAC_06893 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=SMAC_06893 PE=3 SV=1 5 266 1.0E-34
sp|C9S5C6|MEP1_VERA1 Extracellular metalloprotease VDBG_01143 OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=VDBG_01143 PE=3 SV=1 3 266 5.0E-34
sp|C9SSK8|MEP2_VERA1 Extracellular metalloprotease VDBG_07883 OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=VDBG_07883 PE=3 SV=1 17 266 1.0E-33
sp|C5P3X6|MEP1_COCP7 Extracellular metalloprotease 1 OS=Coccidioides posadasii (strain C735) GN=MEP1 PE=1 SV=1 13 264 7.0E-33
sp|B2AC45|MEP1_PODAN Extracellular metalloprotease PODANS_2_14170 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PODANS_2_14170 PE=3 SV=1 16 264 3.0E-31
sp|Q2UBF0|MEP1_ASPOR Extracellular metalloprotease AO090012001025 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090012001025 PE=3 SV=1 14 266 1.0E-27
sp|E4USP0|MEP8_ARTGP Extracellular metalloprotease MGYG_03559 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_03559 PE=3 SV=1 15 266 4.0E-27
sp|E3QKH9|MEP2_COLGM Extracellular metalloprotease GLRG_06511 OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=GLRG_06511 PE=3 SV=1 9 266 1.0E-26
sp|Q4WJ01|MEP1_ASPFU Extracellular metalloprotease AFUA_1G07730 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_1G07730 PE=3 SV=2 16 266 9.0E-26
sp|B0XPZ1|MEP1_ASPFC Extracellular metalloprotease AFUB_008060 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_008060 PE=3 SV=2 16 266 3.0E-25
sp|E4V4I7|MEP6_ARTGP Extracellular metalloprotease MGYG_07913 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_07913 PE=3 SV=1 13 264 3.0E-24
sp|E5QZI4|MEP7_ARTGP Extracellular metalloprotease MGYG_00389 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_00389 PE=3 SV=1 63 264 9.0E-24
sp|D4ALW9|MEP6_ARTBC Extracellular metalloprotease ARB_05317 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05317 PE=1 SV=1 13 264 1.0E-23
sp|C5FL47|MEP7_ARTOC Extracellular metalloprotease MCYG_03238 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_03238 PE=3 SV=1 73 266 2.0E-23
sp|D4DI84|MEP6_TRIVH Extracellular metalloprotease TRV_06892 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_06892 PE=3 SV=2 13 264 2.0E-23
sp|C5FQJ4|MEP6_ARTOC Extracellular metalloprotease MCYG_04966 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_04966 PE=3 SV=1 63 264 3.0E-23
sp|C4K014|MEP1_UNCRE Extracellular metalloprotease UREG_07765 OS=Uncinocarpus reesii (strain UAMH 1704) GN=UREG_07765 PE=3 SV=1 19 264 8.0E-23
sp|D4DIV0|MEP7_TRIVH Extracellular metalloprotease TRV_07111 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_07111 PE=3 SV=1 63 264 6.0E-22
sp|D4ATD1|MEP7_ARTBC Extracellular metalloprotease ARB_07495 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07495 PE=3 SV=1 63 264 6.0E-22
sp|Q8TL28|ULIL_METAC Ulilysin OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_3214 PE=1 SV=1 199 263 6.0E-08
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4583
Ophiocordyceps australis 1348a (Ghana) OphauG2|3462
Ophiocordyceps australis 1348a (Ghana) OphauG2|3271
Ophiocordyceps australis 1348a (Ghana) OphauG2|1070
Ophiocordyceps australis map64 (Brazil) OphauB2|1858
Ophiocordyceps australis map64 (Brazil) OphauB2|7807
Ophiocordyceps australis map64 (Brazil) OphauB2|6069
Ophiocordyceps australis map64 (Brazil) OphauB2|6047
Ophiocordyceps camponoti-floridani Ophcf2|00341
Ophiocordyceps camponoti-floridani Ophcf2|00355
Ophiocordyceps camponoti-floridani Ophcf2|03551
Ophiocordyceps camponoti-floridani Ophcf2|05155
Ophiocordyceps camponoti-floridani Ophcf2|05704
Ophiocordyceps camponoti-floridani Ophcf2|07227
Ophiocordyceps camponoti-floridani Ophcf2|00720
Ophiocordyceps camponoti-rufipedis Ophun1|1354
Ophiocordyceps camponoti-rufipedis Ophun1|1841
Ophiocordyceps camponoti-rufipedis Ophun1|2519
Ophiocordyceps camponoti-rufipedis Ophun1|2683
Ophiocordyceps camponoti-rufipedis Ophun1|3615
Ophiocordyceps camponoti-rufipedis Ophun1|5398
Ophiocordyceps camponoti-rufipedis Ophun1|7222 (this protein)
Ophiocordyceps kimflemingae Ophio5|7575
Ophiocordyceps kimflemingae Ophio5|1310
Ophiocordyceps kimflemingae Ophio5|3287
Ophiocordyceps kimflemingae Ophio5|3438
Ophiocordyceps kimflemingae Ophio5|4474
Ophiocordyceps kimflemingae Ophio5|5248
Ophiocordyceps kimflemingae Ophio5|6057
Ophiocordyceps kimflemingae Ophio5|6793
Ophiocordyceps kimflemingae Ophio5|7576
Ophiocordyceps kimflemingae Ophio5|8134
Ophiocordyceps kimflemingae Ophio5|8139
Ophiocordyceps subramaniannii Hirsu2|2383
Ophiocordyceps subramaniannii Hirsu2|2879
Ophiocordyceps subramaniannii Hirsu2|2880
Ophiocordyceps subramaniannii Hirsu2|5803
Ophiocordyceps subramaniannii Hirsu2|8099
Ophiocordyceps subramaniannii Hirsu2|9120
Ophiocordyceps subramaniannii Hirsu2|6554
Ophiocordyceps subramaniannii Hirsu2|716
Ophiocordyceps subramaniannii Hirsu2|6536
Ophiocordyceps subramaniannii Hirsu2|1174

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7222
MPGPAKTTVKRQAAIVEPISVETYIHVLARDQQLLDRVEVTSCPRETRRGVSLLLTHPELNMLTGQVDTLNRDFR
PSRISFALINIESEVEPEFATLNSTAAVRAMQKRHNKGDEATLNIYIVNEINVPVNHLDCEAPVNSSTAGITEMP
EGGLLGVSSFPWNVIDSSASDSWSNAVIVKADTLPGFLLQLAYSHPRLGKTATHEIGHWFGLFHTFDEDCDTPFG
DLVADTPESASPTTGCPISRDSHPDKPGLDPIHNYMDYSSE*
Coding >Ophun1|7222
ATGCCCGGTCCGGCTAAGACAACCGTGAAGCGACAAGCGGCCATCGTGGAGCCCATCTCGGTTGAGACTTACATC
CACGTCCTCGCCCGTGACCAACAGTTGCTGGACCGCGTCGAGGTGACTTCCTGCCCGCGTGAGACGAGGCGAGGC
GTCTCTCTGTTATTGACGCACCCAGAGCTCAACATGCTGACGGGCCAAGTCGACACCCTGAACCGGGACTTTCGG
CCGTCACGTATCTCGTTTGCCTTGATCAACATCGAGTCCGAAGTCGAGCCCGAGTTCGCCACGCTCAACAGCACC
GCCGCGGTCCGAGCCATGCAAAAGAGGCACAACAAGGGAGACGAGGCGACGCTCAACATCTACATCGTCAACGAA
ATCAACGTCCCCGTCAACCATCTCGACTGCGAGGCCCCCGTCAACAGCTCCACGGCCGGCATCACAGAGATGCCC
GAAGGCGGCCTGCTGGGCGTGTCGAGCTTCCCCTGGAACGTCATCGACAGCTCGGCATCCGATTCGTGGTCCAAT
GCCGTCATTGTCAAAGCCGATACTCTTCCCGGCTTTCTTCTCCAGCTCGCCTATTCCCACCCTCGCCTGGGAAAG
ACGGCCACGCATGAAATCGGCCACTGGTTCGGCTTATTCCACACCTTTGACGAAGACTGCGACACCCCCTTTGGC
GACTTGGTTGCTGACACGCCCGAATCGGCCAGTCCCACAACTGGATGTCCGATAAGCCGAGATTCTCACCCGGAC
AAGCCTGGTCTCGACCCCATCCATAACTATATGGACTATTCCTCCGAGTAG
Transcript >Ophun1|7222
ATGCCCGGTCCGGCTAAGACAACCGTGAAGCGACAAGCGGCCATCGTGGAGCCCATCTCGGTTGAGACTTACATC
CACGTCCTCGCCCGTGACCAACAGTTGCTGGACCGCGTCGAGGTGACTTCCTGCCCGCGTGAGACGAGGCGAGGC
GTCTCTCTGTTATTGACGCACCCAGAGCTCAACATGCTGACGGGCCAAGTCGACACCCTGAACCGGGACTTTCGG
CCGTCACGTATCTCGTTTGCCTTGATCAACATCGAGTCCGAAGTCGAGCCCGAGTTCGCCACGCTCAACAGCACC
GCCGCGGTCCGAGCCATGCAAAAGAGGCACAACAAGGGAGACGAGGCGACGCTCAACATCTACATCGTCAACGAA
ATCAACGTCCCCGTCAACCATCTCGACTGCGAGGCCCCCGTCAACAGCTCCACGGCCGGCATCACAGAGATGCCC
GAAGGCGGCCTGCTGGGCGTGTCGAGCTTCCCCTGGAACGTCATCGACAGCTCGGCATCCGATTCGTGGTCCAAT
GCCGTCATTGTCAAAGCCGATACTCTTCCCGGCTTTCTTCTCCAGCTCGCCTATTCCCACCCTCGCCTGGGAAAG
ACGGCCACGCATGAAATCGGCCACTGGTTCGGCTTATTCCACACCTTTGACGAAGACTGCGACACCCCCTTTGGC
GACTTGGTTGCTGACACGCCCGAATCGGCCAGTCCCACAACTGGATGTCCGATAAGCCGAGATTCTCACCCGGAC
AAGCCTGGTCTCGACCCCATCCATAACTATATGGACTATTCCTCCGAGTAG
Gene >Ophun1|7222
ATGCCCGGTCCGGCTAAGACAACCGTGAAGCGACAAGCGGCCATCGTGGAGCCCATCTCGGTTGAGACTTACATC
CACGTCCTCGCCCGTGACCAACAGTTGCTGGACCGCGTCGAGGTGACTTCCTGCCCGCGTGAGACGAGGCGAGGC
GTCTCTCTGTTATTGACGCACCCAGAGCTCAACATGCTGACGGGCCAAGTCGACACCCTGAACCGGGACTTTCGG
CCGTCACGTATCTCGTTTGCCTTGATCAACATCGAGTCCGAAGTCGAGCCCGAGTTCGCCACGCTCAACAGCACC
GCCGCGGTCCGAGCCATGCAAAAGAGGCACAACAAGGGAGACGAGGCGACGCTCAACATCTACATCGTCAACGAA
ATCAACGTCCCCGTCAACCATCTCGACTGCGAGGCCCCCGTCAACAGCTCCACGGCCGGCATCACAGAGATGCCC
GAAGGCGGCCTGCTGGGCGTGTCGAGCTTCCCCTGGAACGTCATCGACAGCTCGGCATCCGATTCGTGGTCCAAT
GCCGTCATTGTCAAAGCCGATACTCTTCCCGGCTTTCTTCTCCAGCTCGCCTATTCCCACCCTCGCCTGGGAAAG
ACGGCCACGCATGAAATCGGCCACTGGTTCGGCTTATTCCACACCTTTGACGAAGACTGCGACACCCCCTTTGGC
GACTTGGTTGCTGACACGCCCGAATCGGCCAGTCCCACAACTGGATGTCCGATAAGCCGAGATTCTCACCCGGAC
AAGCCTGGTCTCGACCCCATCCATAACTATATGGACTATTCCTCCGAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail