Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|722
Gene name
LocationContig_124:4904..6974
Strand+
Gene length (bp)2070
Transcript length (bp)2070
Coding sequence length (bp)2070
Protein length (aa) 690

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12709 Fungal_TACC Fungal Transforming acidic coiled-coil (TACC) proteins 8.5E-11 443 504

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4747
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7350
Ophiocordyceps australis map64 (Brazil) OphauB2|5287
Ophiocordyceps camponoti-floridani Ophcf2|02070
Ophiocordyceps camponoti-floridani Ophcf2|07422
Ophiocordyceps camponoti-rufipedis Ophun1|722 (this protein)
Ophiocordyceps kimflemingae Ophio5|3908

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|722
MASSPLRTVQQQELNPQRRQEASNSGDESSAFVSTVGETSASEQENWAGKPSSEPESTSRPTSKASRHSRVLSGT
ELSPLRILTEQRSSSPETAGTRSPRRVLLEKRFPVKISGGGRDEATMLPPPVVAVQEPERAVVENQEQQDGEATD
DEDDEGGPTGGFSAVPDEAACPDDTMMSTFSNFSAIPNLTMLARLGGQSPSKLGLSPRGRRDGWPADNTTTNLLM
DFTEQMRFPQGRGQGISPSRPVASTPLRPAANVNLIDLEMPPLPTPRSIPTITPRELESLKSGFLSEISSLKASL
SGKEAEVQSLKAAVGDAEKRVGESQEQLREARSTREQLEAERESWEARGRDVEAVLERVRRDMVMGQAERDELEK
KLDESEKRREAAEMLHQEAESKMAGMRAGKDGAGAGGRPLSLSAATTTTTLNNNNNNNNSSSSKADVEAAVEHVA
RELHALYKTKHDTKVAALKKSYESRWSKKVAALEQQLSDLGAEATALRQQLSSAAAAAAAPPSADEELRAQAVRD
SAAIKELGADVDRLEAVVRTVRRDNDELRASLEAERVEKGELVLLAEELMSIQTAAAPPAPSPARRTTQHHQPTS
TTTTPQRPTSQRAAQPQSLRRPIEAKTPRGPPAPRTSGLRLPAPSGLRAPPGHERVRGGGGGGALPRPGGARSGI
MSNIERMGNFRGGA*
Coding >Ophun1|722
ATGGCTTCGTCGCCGCTGCGGACGGTGCAGCAGCAGGAGCTGAATCCGCAGAGGAGACAGGAAGCGTCCAACAGC
GGAGACGAGTCGTCGGCCTTTGTGTCGACGGTGGGCGAGACGAGCGCTTCTGAGCAGGAGAATTGGGCTGGAAAG
CCGTCGTCGGAGCCGGAATCGACGAGCCGACCGACGTCCAAGGCGTCGCGGCATAGTCGGGTGCTGTCGGGCACG
GAGCTGTCGCCGCTGAGGATCTTGACGGAGCAGAGGAGCTCGTCGCCCGAGACGGCGGGGACGCGCAGCCCTAGG
AGGGTGTTGCTGGAGAAGAGGTTTCCTGTCAAGATCAGCGGTGGTGGGCGGGATGAGGCGACGATGCTGCCGCCG
CCGGTGGTTGCTGTTCAGGAGCCGGAGCGGGCCGTCGTCGAGAATCAAGAACAGCAAGATGGCGAGGCGACGGAC
GATGAGGACGACGAAGGAGGTCCGACTGGGGGCTTCTCAGCCGTTCCGGACGAAGCGGCCTGTCCAGACGACACC
ATGATGAGCACCTTTAGCAACTTCTCGGCCATTCCCAACCTGACGATGCTGGCCAGGCTGGGAGGTCAAAGTCCG
TCCAAGCTGGGTCTCAGCCCACGGGGTCGTCGCGATGGCTGGCCCGCAGACAACACGACGACGAACCTGTTGATG
GACTTTACCGAGCAGATGCGCTTCCCGCAGGGTCGTGGCCAGGGCATCTCGCCGTCGCGACCAGTGGCCTCGACT
CCTCTACGGCCAGCGGCCAACGTCAACCTCATCGACCTGGAGATGCCACCGCTTCCGACGCCCCGAAGCATCCCG
ACCATCACGCCCCGCGAGCTCGAGTCCCTCAAGTCAGGCTTCCTGTCGGAAATAAGCTCGCTCAAGGCGTCGCTC
AGCGGCAAGGAAGCCGAGGTGCAATCCCTCAAGGCGGCCGTGGGCGACGCGGAGAAGCGGGTGGGCGAGTCGCAA
GAGCAGCTGCGCGAGGCGCGCTCCACGCGAGAGCAGCTCGAGGCTGAGCGCGAAAGCTGGGAGGCCCGCGGACGG
GATGTCGAGGCTGTGCTGGAGAGGGTCCGTCGCGATATGGTTATGGGTCAGGCTGAGCGTGACGAGCTGGAGAAG
AAGCTTGATGAGAGCGAGAAGAGGCGGGAGGCGGCTGAGATGCTGCATCAGGAGGCGGAGAGTAAGATGGCTGGC
ATGAGGGCCGGTAAGGACGGGGCTGGAGCGGGAGGGCGTCCGCTTTCTCTCTCGGCGGCCACGACGACGACGACT
CTTAACAACAACAACAACAACAACAACAGCAGCAGTTCCAAGGCCGACGTCGAAGCAGCCGTCGAGCACGTCGCC
CGCGAACTCCACGCCCTCTACAAGACCAAGCACGACACCAAAGTAGCCGCCCTCAAGAAGTCGTACGAATCCCGC
TGGTCCAAAAAGGTGGCAGCCCTGGAGCAGCAACTCTCGGACCTCGGCGCCGAAGCCACCGCCCTCCGCCAGCAG
CTCTCTTCCGCCGCCGCCGCCGCCGCCGCTCCCCCCTCGGCGGACGAAGAGTTGCGGGCGCAGGCCGTGCGAGAC
AGCGCGGCCATCAAGGAGCTCGGCGCCGACGTCGATCGCCTCGAGGCGGTTGTTCGCACCGTTCGCAGGGATAAT
GATGAGCTGAGGGCTTCGCTTGAGGCTGAGAGGGTGGAGAAGGGCGAGTTGGTTCTCTTGGCTGAGGAGTTGATG
AGCATCCAGACGGCCGCCGCCCCCCCCGCGCCCTCACCCGCAAGACGAACAACGCAGCATCACCAACCGACATCA
ACGACTACAACCCCCCAGCGCCCGACCTCGCAGCGCGCCGCCCAACCGCAGAGCCTCCGCCGCCCCATCGAAGCA
AAGACGCCCCGAGGTCCGCCCGCCCCGCGAACATCGGGCCTCCGCCTCCCCGCTCCGTCGGGACTGCGCGCTCCG
CCCGGCCATGAGCGTGTCCGGGGCGGAGGAGGAGGAGGAGCGCTGCCGAGGCCCGGGGGGGCGCGGAGTGGCATC
ATGAGTAATATCGAGAGGATGGGGAACTTTCGGGGGGGGGCTTGA
Transcript >Ophun1|722
ATGGCTTCGTCGCCGCTGCGGACGGTGCAGCAGCAGGAGCTGAATCCGCAGAGGAGACAGGAAGCGTCCAACAGC
GGAGACGAGTCGTCGGCCTTTGTGTCGACGGTGGGCGAGACGAGCGCTTCTGAGCAGGAGAATTGGGCTGGAAAG
CCGTCGTCGGAGCCGGAATCGACGAGCCGACCGACGTCCAAGGCGTCGCGGCATAGTCGGGTGCTGTCGGGCACG
GAGCTGTCGCCGCTGAGGATCTTGACGGAGCAGAGGAGCTCGTCGCCCGAGACGGCGGGGACGCGCAGCCCTAGG
AGGGTGTTGCTGGAGAAGAGGTTTCCTGTCAAGATCAGCGGTGGTGGGCGGGATGAGGCGACGATGCTGCCGCCG
CCGGTGGTTGCTGTTCAGGAGCCGGAGCGGGCCGTCGTCGAGAATCAAGAACAGCAAGATGGCGAGGCGACGGAC
GATGAGGACGACGAAGGAGGTCCGACTGGGGGCTTCTCAGCCGTTCCGGACGAAGCGGCCTGTCCAGACGACACC
ATGATGAGCACCTTTAGCAACTTCTCGGCCATTCCCAACCTGACGATGCTGGCCAGGCTGGGAGGTCAAAGTCCG
TCCAAGCTGGGTCTCAGCCCACGGGGTCGTCGCGATGGCTGGCCCGCAGACAACACGACGACGAACCTGTTGATG
GACTTTACCGAGCAGATGCGCTTCCCGCAGGGTCGTGGCCAGGGCATCTCGCCGTCGCGACCAGTGGCCTCGACT
CCTCTACGGCCAGCGGCCAACGTCAACCTCATCGACCTGGAGATGCCACCGCTTCCGACGCCCCGAAGCATCCCG
ACCATCACGCCCCGCGAGCTCGAGTCCCTCAAGTCAGGCTTCCTGTCGGAAATAAGCTCGCTCAAGGCGTCGCTC
AGCGGCAAGGAAGCCGAGGTGCAATCCCTCAAGGCGGCCGTGGGCGACGCGGAGAAGCGGGTGGGCGAGTCGCAA
GAGCAGCTGCGCGAGGCGCGCTCCACGCGAGAGCAGCTCGAGGCTGAGCGCGAAAGCTGGGAGGCCCGCGGACGG
GATGTCGAGGCTGTGCTGGAGAGGGTCCGTCGCGATATGGTTATGGGTCAGGCTGAGCGTGACGAGCTGGAGAAG
AAGCTTGATGAGAGCGAGAAGAGGCGGGAGGCGGCTGAGATGCTGCATCAGGAGGCGGAGAGTAAGATGGCTGGC
ATGAGGGCCGGTAAGGACGGGGCTGGAGCGGGAGGGCGTCCGCTTTCTCTCTCGGCGGCCACGACGACGACGACT
CTTAACAACAACAACAACAACAACAACAGCAGCAGTTCCAAGGCCGACGTCGAAGCAGCCGTCGAGCACGTCGCC
CGCGAACTCCACGCCCTCTACAAGACCAAGCACGACACCAAAGTAGCCGCCCTCAAGAAGTCGTACGAATCCCGC
TGGTCCAAAAAGGTGGCAGCCCTGGAGCAGCAACTCTCGGACCTCGGCGCCGAAGCCACCGCCCTCCGCCAGCAG
CTCTCTTCCGCCGCCGCCGCCGCCGCCGCTCCCCCCTCGGCGGACGAAGAGTTGCGGGCGCAGGCCGTGCGAGAC
AGCGCGGCCATCAAGGAGCTCGGCGCCGACGTCGATCGCCTCGAGGCGGTTGTTCGCACCGTTCGCAGGGATAAT
GATGAGCTGAGGGCTTCGCTTGAGGCTGAGAGGGTGGAGAAGGGCGAGTTGGTTCTCTTGGCTGAGGAGTTGATG
AGCATCCAGACGGCCGCCGCCCCCCCCGCGCCCTCACCCGCAAGACGAACAACGCAGCATCACCAACCGACATCA
ACGACTACAACCCCCCAGCGCCCGACCTCGCAGCGCGCCGCCCAACCGCAGAGCCTCCGCCGCCCCATCGAAGCA
AAGACGCCCCGAGGTCCGCCCGCCCCGCGAACATCGGGCCTCCGCCTCCCCGCTCCGTCGGGACTGCGCGCTCCG
CCCGGCCATGAGCGTGTCCGGGGCGGAGGAGGAGGAGGAGCGCTGCCGAGGCCCGGGGGGGCGCGGAGTGGCATC
ATGAGTAATATCGAGAGGATGGGGAACTTTCGGGGGGGGGCTTGA
Gene >Ophun1|722
ATGGCTTCGTCGCCGCTGCGGACGGTGCAGCAGCAGGAGCTGAATCCGCAGAGGAGACAGGAAGCGTCCAACAGC
GGAGACGAGTCGTCGGCCTTTGTGTCGACGGTGGGCGAGACGAGCGCTTCTGAGCAGGAGAATTGGGCTGGAAAG
CCGTCGTCGGAGCCGGAATCGACGAGCCGACCGACGTCCAAGGCGTCGCGGCATAGTCGGGTGCTGTCGGGCACG
GAGCTGTCGCCGCTGAGGATCTTGACGGAGCAGAGGAGCTCGTCGCCCGAGACGGCGGGGACGCGCAGCCCTAGG
AGGGTGTTGCTGGAGAAGAGGTTTCCTGTCAAGATCAGCGGTGGTGGGCGGGATGAGGCGACGATGCTGCCGCCG
CCGGTGGTTGCTGTTCAGGAGCCGGAGCGGGCCGTCGTCGAGAATCAAGAACAGCAAGATGGCGAGGCGACGGAC
GATGAGGACGACGAAGGAGGTCCGACTGGGGGCTTCTCAGCCGTTCCGGACGAAGCGGCCTGTCCAGACGACACC
ATGATGAGCACCTTTAGCAACTTCTCGGCCATTCCCAACCTGACGATGCTGGCCAGGCTGGGAGGTCAAAGTCCG
TCCAAGCTGGGTCTCAGCCCACGGGGTCGTCGCGATGGCTGGCCCGCAGACAACACGACGACGAACCTGTTGATG
GACTTTACCGAGCAGATGCGCTTCCCGCAGGGTCGTGGCCAGGGCATCTCGCCGTCGCGACCAGTGGCCTCGACT
CCTCTACGGCCAGCGGCCAACGTCAACCTCATCGACCTGGAGATGCCACCGCTTCCGACGCCCCGAAGCATCCCG
ACCATCACGCCCCGCGAGCTCGAGTCCCTCAAGTCAGGCTTCCTGTCGGAAATAAGCTCGCTCAAGGCGTCGCTC
AGCGGCAAGGAAGCCGAGGTGCAATCCCTCAAGGCGGCCGTGGGCGACGCGGAGAAGCGGGTGGGCGAGTCGCAA
GAGCAGCTGCGCGAGGCGCGCTCCACGCGAGAGCAGCTCGAGGCTGAGCGCGAAAGCTGGGAGGCCCGCGGACGG
GATGTCGAGGCTGTGCTGGAGAGGGTCCGTCGCGATATGGTTATGGGTCAGGCTGAGCGTGACGAGCTGGAGAAG
AAGCTTGATGAGAGCGAGAAGAGGCGGGAGGCGGCTGAGATGCTGCATCAGGAGGCGGAGAGTAAGATGGCTGGC
ATGAGGGCCGGTAAGGACGGGGCTGGAGCGGGAGGGCGTCCGCTTTCTCTCTCGGCGGCCACGACGACGACGACT
CTTAACAACAACAACAACAACAACAACAGCAGCAGTTCCAAGGCCGACGTCGAAGCAGCCGTCGAGCACGTCGCC
CGCGAACTCCACGCCCTCTACAAGACCAAGCACGACACCAAAGTAGCCGCCCTCAAGAAGTCGTACGAATCCCGC
TGGTCCAAAAAGGTGGCAGCCCTGGAGCAGCAACTCTCGGACCTCGGCGCCGAAGCCACCGCCCTCCGCCAGCAG
CTCTCTTCCGCCGCCGCCGCCGCCGCCGCTCCCCCCTCGGCGGACGAAGAGTTGCGGGCGCAGGCCGTGCGAGAC
AGCGCGGCCATCAAGGAGCTCGGCGCCGACGTCGATCGCCTCGAGGCGGTTGTTCGCACCGTTCGCAGGGATAAT
GATGAGCTGAGGGCTTCGCTTGAGGCTGAGAGGGTGGAGAAGGGCGAGTTGGTTCTCTTGGCTGAGGAGTTGATG
AGCATCCAGACGGCCGCCGCCCCCCCCGCGCCCTCACCCGCAAGACGAACAACGCAGCATCACCAACCGACATCA
ACGACTACAACCCCCCAGCGCCCGACCTCGCAGCGCGCCGCCCAACCGCAGAGCCTCCGCCGCCCCATCGAAGCA
AAGACGCCCCGAGGTCCGCCCGCCCCGCGAACATCGGGCCTCCGCCTCCCCGCTCCGTCGGGACTGCGCGCTCCG
CCCGGCCATGAGCGTGTCCGGGGCGGAGGAGGAGGAGGAGCGCTGCCGAGGCCCGGGGGGGCGCGGAGTGGCATC
ATGAGTAATATCGAGAGGATGGGGAACTTTCGGGGGGGGGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail