Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7219
Gene name
LocationContig_88:10155..11074
Strand+
Gene length (bp)919
Transcript length (bp)861
Coding sequence length (bp)861
Protein length (aa) 287

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06912 DUF1275 Protein of unknown function (DUF1275) 1.2E-42 65 269

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

Domain # Start End Length
1 111 130 19
2 143 162 19
3 172 191 19
4 231 248 17
5 252 274 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7219
MFCRLPLQAAKHAPEKKSRAPEPVSQEISSKTSAGSFWPVTPERSRLLSHFSDDVRSSLFAEAQLVLLTFCTGIQ
DVTTFLDYHCFASNQTGNTVFLCIALIISQIEGDTFVTANVGMSLGVFLAAGWLTGQLSHVIGGRKRWWLVSCNL
LQTALVFTVAGIQYRYGSSDRGPVALGVIALLAFAAGGQVVQSRSLRITEISTAMATAAWVDLVMDGKLFVLHNR
PRNRRVAFLTALAVGSLVGAAVYRQLGSAAAIAISAAGKLLVTVLYLFSPAESQRQEEAEV*
Coding >Ophun1|7219
ATGTTCTGTCGCCTGCCTCTTCAGGCGGCAAAGCACGCCCCAGAGAAGAAGTCGAGGGCTCCCGAGCCCGTATCC
CAGGAGATCTCGTCCAAAACCAGCGCCGGCTCCTTCTGGCCCGTTACACCGGAACGGAGCCGGCTTCTCAGCCAC
TTCTCCGACGATGTCCGCTCCTCCCTCTTCGCCGAGGCGCAGCTCGTGCTTCTGACCTTTTGCACGGGAATTCAA
GACGTCACCACCTTTCTCGACTATCACTGCTTCGCCTCGAACCAGACCGGCAACACCGTCTTCCTCTGCATCGCC
CTCATCATCTCCCAGATCGAGGGCGACACCTTCGTGACGGCCAACGTCGGCATGTCCCTCGGCGTCTTCCTGGCC
GCAGGATGGTTGACGGGCCAGCTGAGCCATGTCATCGGTGGGCGGAAGCGTTGGTGGCTGGTCTCGTGCAATCTT
CTTCAAACGGCCCTCGTCTTCACCGTAGCCGGGATCCAGTACCGGTACGGCAGCTCCGATCGCGGACCCGTCGCC
CTCGGCGTCATAGCCCTGTTGGCCTTTGCCGCGGGGGGGCAAGTGGTTCAGTCTCGCAGCCTGCGCATCACCGAG
ATCAGCACTGCCATGGCGACAGCGGCCTGGGTGGACCTCGTCATGGACGGGAAGCTGTTTGTGCTGCACAACCGA
CCGAGGAATCGCCGCGTCGCCTTTCTGACTGCTCTGGCCGTCGGATCTCTCGTTGGCGCCGCCGTCTACCGTCAG
CTGGGCTCGGCGGCTGCCATTGCGATATCTGCGGCTGGCAAACTGCTCGTCACGGTCCTCTATCTGTTTTCGCCC
GCTGAGTCCCAGCGACAGGAGGAGGCAGAGGTGTGA
Transcript >Ophun1|7219
ATGTTCTGTCGCCTGCCTCTTCAGGCGGCAAAGCACGCCCCAGAGAAGAAGTCGAGGGCTCCCGAGCCCGTATCC
CAGGAGATCTCGTCCAAAACCAGCGCCGGCTCCTTCTGGCCCGTTACACCGGAACGGAGCCGGCTTCTCAGCCAC
TTCTCCGACGATGTCCGCTCCTCCCTCTTCGCCGAGGCGCAGCTCGTGCTTCTGACCTTTTGCACGGGAATTCAA
GACGTCACCACCTTTCTCGACTATCACTGCTTCGCCTCGAACCAGACCGGCAACACCGTCTTCCTCTGCATCGCC
CTCATCATCTCCCAGATCGAGGGCGACACCTTCGTGACGGCCAACGTCGGCATGTCCCTCGGCGTCTTCCTGGCC
GCAGGATGGTTGACGGGCCAGCTGAGCCATGTCATCGGTGGGCGGAAGCGTTGGTGGCTGGTCTCGTGCAATCTT
CTTCAAACGGCCCTCGTCTTCACCGTAGCCGGGATCCAGTACCGGTACGGCAGCTCCGATCGCGGACCCGTCGCC
CTCGGCGTCATAGCCCTGTTGGCCTTTGCCGCGGGGGGGCAAGTGGTTCAGTCTCGCAGCCTGCGCATCACCGAG
ATCAGCACTGCCATGGCGACAGCGGCCTGGGTGGACCTCGTCATGGACGGGAAGCTGTTTGTGCTGCACAACCGA
CCGAGGAATCGCCGCGTCGCCTTTCTGACTGCTCTGGCCGTCGGATCTCTCGTTGGCGCCGCCGTCTACCGTCAG
CTGGGCTCGGCGGCTGCCATTGCGATATCTGCGGCTGGCAAACTGCTCGTCACGGTCCTCTATCTGTTTTCGCCC
GCTGAGTCCCAGCGACAGGAGGAGGCAGAGGTGTGA
Gene >Ophun1|7219
ATGTTCTGTCGCCTGCCTCTTCAGGCGGCAAAGCACGCCCCAGAGAAGAAGTCGAGGGCTCCCGAGCCCGTATCC
CAGGAGATCTCGTCCAAAACCAGCGCCGGCTCCTTCTGGCCCGTTACACCGGAACGGAGCCGGCTTCTCAGCCAC
TTCTCCGACGATGTCCGCTCCTCCCTCTTCGCCGAGGCGCAGCTCGTGCTTCTGACCTTTTGCACGGGAATTCAA
GGTGGACAGGAGAGCCCTCTTCGTGATTGTATGCTGAAGCTGACACGGCCGAACGCCAGACGTCACCACCTTTCT
CGACTATCACTGCTTCGCCTCGAACCAGACCGGCAACACCGTCTTCCTCTGCATCGCCCTCATCATCTCCCAGAT
CGAGGGCGACACCTTCGTGACGGCCAACGTCGGCATGTCCCTCGGCGTCTTCCTGGCCGCAGGATGGTTGACGGG
CCAGCTGAGCCATGTCATCGGTGGGCGGAAGCGTTGGTGGCTGGTCTCGTGCAATCTTCTTCAAACGGCCCTCGT
CTTCACCGTAGCCGGGATCCAGTACCGGTACGGCAGCTCCGATCGCGGACCCGTCGCCCTCGGCGTCATAGCCCT
GTTGGCCTTTGCCGCGGGGGGGCAAGTGGTTCAGTCTCGCAGCCTGCGCATCACCGAGATCAGCACTGCCATGGC
GACAGCGGCCTGGGTGGACCTCGTCATGGACGGGAAGCTGTTTGTGCTGCACAACCGACCGAGGAATCGCCGCGT
CGCCTTTCTGACTGCTCTGGCCGTCGGATCTCTCGTTGGCGCCGCCGTCTACCGTCAGCTGGGCTCGGCGGCTGC
CATTGCGATATCTGCGGCTGGCAAACTGCTCGTCACGGTCCTCTATCTGTTTTCGCCCGCTGAGTCCCAGCGACA
GGAGGAGGCAGAGGTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail