Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7215
Gene name
LocationContig_878:5205..5547
Strand-
Gene length (bp)342
Transcript length (bp)282
Coding sequence length (bp)282
Protein length (aa) 94

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00125 Histone Core histone H2A/H2B/H3/H4 1.3E-10 4 82

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P37210|H2B_NEUCR Histone H2B OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hh2b PE=1 SV=4 1 83 4.0E-45
sp|Q875B7|H2B_PODAS Histone H2B OS=Podospora anserina GN=HTB1 PE=3 SV=3 1 83 4.0E-45
sp|Q2HH38|H2B_CHAGB Histone H2B OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=HTB1 PE=3 SV=3 1 83 1.0E-44
sp|L7I1W3|H2B_MAGOY Histone H2B OS=Magnaporthe oryzae (strain Y34) GN=HTB1 PE=2 SV=1 1 83 2.0E-40
sp|P0CT13|H2B_MAGO7 Histone H2B OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=HTB1 PE=3 SV=1 1 83 2.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P37210|H2B_NEUCR Histone H2B OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hh2b PE=1 SV=4 1 83 4.0E-45
sp|Q875B7|H2B_PODAS Histone H2B OS=Podospora anserina GN=HTB1 PE=3 SV=3 1 83 4.0E-45
sp|Q2HH38|H2B_CHAGB Histone H2B OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=HTB1 PE=3 SV=3 1 83 1.0E-44
sp|L7I1W3|H2B_MAGOY Histone H2B OS=Magnaporthe oryzae (strain Y34) GN=HTB1 PE=2 SV=1 1 83 2.0E-40
sp|P0CT13|H2B_MAGO7 Histone H2B OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=HTB1 PE=3 SV=1 1 83 2.0E-40
sp|Q4HTT2|H2B_GIBZE Histone H2B OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=HTB1 PE=3 SV=3 1 83 2.0E-39
sp|Q7Z9J4|H2B_AJECA Histone H2B OS=Ajellomyces capsulatus GN=HTB1 PE=3 SV=3 1 78 7.0E-38
sp|A1CJ09|H2B_ASPCL Histone H2B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=htb1 PE=3 SV=1 1 78 2.0E-35
sp|Q1E5N0|H2B_COCIM Histone H2B OS=Coccidioides immitis (strain RS) GN=HTB1 PE=3 SV=1 1 78 2.0E-35
sp|Q0CBD1|H2B_ASPTN Histone H2B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=htb1 PE=3 SV=1 1 78 3.0E-35
sp|P23754|H2B_EMENI Histone H2B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=htbA PE=3 SV=2 1 78 6.0E-35
sp|A2QY49|H2B_ASPNC Histone H2B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=htb1 PE=3 SV=1 1 78 1.0E-34
sp|Q2U5A9|H2B_ASPOR Histone H2B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=htb1 PE=3 SV=3 1 78 1.0E-33
sp|Q8J1K2|H2B_ROSNE Histone H2B OS=Rosellinia necatrix GN=hh2b PE=3 SV=3 18 78 2.0E-33
sp|Q6C4I7|H2B_YARLI Histone H2B OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HTB1 PE=3 SV=3 1 78 5.0E-31
sp|A3LXE6|H2B2_PICST Histone H2B.2 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=HTB2 PE=3 SV=1 1 83 6.0E-30
sp|A3LZZ1|HSB1_PICST Histone H2B.1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=HTB1 PE=3 SV=1 1 83 1.0E-29
sp|Q6BKW7|H2B2_DEBHA Histone H2B.2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HTB2 PE=3 SV=3 1 78 5.0E-29
sp|P02294|H2B2_YEAST Histone H2B.2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HTB2 PE=1 SV=2 5 83 6.0E-29
sp|A1D8G9|H2B_NEOFI Histone H2B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=htb1 PE=3 SV=1 1 78 8.0E-29
sp|Q4WWC5|H2B_ASPFU Histone H2B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=htb1 PE=3 SV=3 1 78 8.0E-29
sp|P02293|H2B1_YEAST Histone H2B.1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HTB1 PE=1 SV=2 6 83 2.0E-28
sp|Q6BRG2|H2B1_DEBHA Histone H2B.1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HTB1 PE=3 SV=3 1 78 3.0E-28
sp|A5DBG5|H2B2_PICGU Histone H2B.2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=HTB2 PE=3 SV=1 1 83 3.0E-28
sp|A5DJJ1|H2B1_PICGU Histone H2B.1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=HTB1 PE=3 SV=1 1 83 6.0E-28
sp|Q6FWM8|H2B1_CANGA Histone H2B.1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HTB1 PE=3 SV=3 5 83 1.0E-27
sp|Q6FM30|H2B2_CANGA Histone H2B.2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HTB2 PE=3 SV=3 6 83 1.0E-27
sp|P48989|H2B1_CANAL Histone H2B.1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HTB1 PE=3 SV=3 1 83 3.0E-27
sp|Q59VP1|H2B2_CANAL Histone H2B.2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HTB2 PE=3 SV=3 1 83 3.0E-27
sp|Q4PEF8|H2B_USTMA Histone H2B OS=Ustilago maydis (strain 521 / FGSC 9021) GN=HTB1 PE=3 SV=3 1 83 9.0E-27
sp|A5DWF0|H2B_LODEL Histone H2B OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=HTB1 PE=3 SV=1 1 83 9.0E-27
sp|Q6CMV8|H2B2_KLULA Histone H2B.2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HTB1 PE=3 SV=3 1 83 2.0E-26
sp|Q74ZL5|H2B1_ASHGO Histone H2B.1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HTB1 PE=3 SV=3 6 83 2.0E-25
sp|Q8J1F8|H2B2_ASHGO Histone H2B.2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HTB2 PE=3 SV=3 1 83 8.0E-25
sp|Q6CK60|H2B1_KLULA Histone H2B.1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HTB1 PE=3 SV=3 6 83 9.0E-25
sp|P04913|H2B1_SCHPO Histone H2B-alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=htb1 PE=1 SV=3 5 83 3.0E-24
sp|Q0U1A0|H2B_PHANO Histone H2B OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=HTB1 PE=3 SV=1 1 77 7.0E-23
sp|Q9PSW9|H2B8_CHICK Histone H2B 8 OS=Gallus gallus GN=H2B-VIII PE=1 SV=3 15 92 8.0E-20
sp|Q6PC60|H2B3_DANRE Histone H2B 3 OS=Danio rerio GN=hist2h2l PE=2 SV=3 15 92 2.0E-19
sp|P0C1H4|H2B5_CHICK Histone H2B 5 OS=Gallus gallus GN=H2B-V PE=1 SV=2 15 92 2.0E-19
sp|P78567|H2B_AGABI Histone H2B OS=Agaricus bisporus GN=htbA PE=2 SV=3 1 78 3.0E-19
sp|P0C1H5|H2B7_CHICK Histone H2B 7 OS=Gallus gallus GN=H2B-VII PE=1 SV=2 15 92 4.0E-19
sp|Q99880|H2B1L_HUMAN Histone H2B type 1-L OS=Homo sapiens GN=HIST1H2BL PE=1 SV=3 15 92 1.0E-18
sp|Q64524|H2B2E_MOUSE Histone H2B type 2-E OS=Mus musculus GN=Hist2h2be PE=1 SV=3 15 92 1.0E-18
sp|Q8CGP1|H2B1K_MOUSE Histone H2B type 1-K OS=Mus musculus GN=Hist1h2bk PE=1 SV=3 15 92 2.0E-18
sp|P02281|H2B11_XENLA Histone H2B 1.1 OS=Xenopus laevis PE=1 SV=2 15 92 2.0E-18
sp|P10853|H2B1F_MOUSE Histone H2B type 1-F/J/L OS=Mus musculus GN=Hist1h2bf PE=1 SV=2 15 92 2.0E-18
sp|O60814|H2B1K_HUMAN Histone H2B type 1-K OS=Homo sapiens GN=HIST1H2BK PE=1 SV=3 15 92 2.0E-18
sp|Q2M2T1|H2B1K_BOVIN Histone H2B type 1-K OS=Bos taurus GN=HIST1H2BK PE=1 SV=3 15 92 2.0E-18
sp|Q5R893|H2B1_PONAB Histone H2B type 1 OS=Pongo abelii PE=2 SV=3 15 92 2.0E-18
sp|P62808|H2B1_BOVIN Histone H2B type 1 OS=Bos taurus PE=1 SV=2 15 92 2.0E-18
sp|Q6ZWY9|H2B1C_MOUSE Histone H2B type 1-C/E/G OS=Mus musculus GN=Hist1h2bc PE=1 SV=3 15 92 2.0E-18
sp|P62807|H2B1C_HUMAN Histone H2B type 1-C/E/F/G/I OS=Homo sapiens GN=HIST1H2BC PE=1 SV=4 15 92 2.0E-18
sp|Q5BJA5|H2B1_DANRE Histone H2B 1/2 OS=Danio rerio GN=zgc:112234 PE=2 SV=3 9 92 3.0E-18
sp|P02289|H2BE_STRPU Histone H2B, embryonic OS=Strongylocentrotus purpuratus PE=1 SV=2 17 78 3.0E-18
sp|P06899|H2B1J_HUMAN Histone H2B type 1-J OS=Homo sapiens GN=HIST1H2BJ PE=1 SV=3 15 92 3.0E-18
sp|Q16778|H2B2E_HUMAN Histone H2B type 2-E OS=Homo sapiens GN=HIST2H2BE PE=1 SV=3 15 92 3.0E-18
sp|Q75VN4|H2B_RHASC Histone H2B OS=Rhacophorus schlegelii GN=histh2b PE=1 SV=3 15 92 3.0E-18
sp|Q64478|H2B1H_MOUSE Histone H2B type 1-H OS=Mus musculus GN=Hist1h2bh PE=1 SV=3 15 92 3.0E-18
sp|P57053|H2BFS_HUMAN Histone H2B type F-S OS=Homo sapiens GN=H2BFS PE=1 SV=2 15 78 4.0E-18
sp|Q93079|H2B1H_HUMAN Histone H2B type 1-H OS=Homo sapiens GN=HIST1H2BH PE=1 SV=3 15 92 4.0E-18
sp|P05621|H2B2_WHEAT Histone H2B.2 OS=Triticum aestivum PE=1 SV=2 4 92 4.0E-18
sp|P23527|H2B1O_HUMAN Histone H2B type 1-O OS=Homo sapiens GN=HIST1H2BO PE=1 SV=3 15 92 5.0E-18
sp|P69070|H2B_SALTR Histone H2B OS=Salmo trutta PE=1 SV=2 9 92 6.0E-18
sp|P69069|H2B_ONCMY Histone H2B OS=Oncorhynchus mykiss PE=1 SV=2 9 92 6.0E-18
sp|P83863|H2B_LITVA Histone H2B (Fragments) OS=Litopenaeus vannamei PE=1 SV=2 29 92 7.0E-18
sp|Q99877|H2B1N_HUMAN Histone H2B type 1-N OS=Homo sapiens GN=HIST1H2BN PE=1 SV=3 15 92 8.0E-18
sp|Q5QNW6|H2B2F_HUMAN Histone H2B type 2-F OS=Homo sapiens GN=HIST2H2BF PE=1 SV=3 15 92 9.0E-18
sp|Q64525|H2B2B_MOUSE Histone H2B type 2-B OS=Mus musculus GN=Hist2h2bb PE=1 SV=3 15 92 9.0E-18
sp|P48557|H2B_HOLTU Histone H2B OS=Holothuria tubulosa PE=3 SV=1 35 78 1.0E-17
sp|P10854|H2B1M_MOUSE Histone H2B type 1-M OS=Mus musculus GN=Hist1h2bm PE=1 SV=2 21 92 1.0E-17
sp|P58876|H2B1D_HUMAN Histone H2B type 1-D OS=Homo sapiens GN=HIST1H2BD PE=1 SV=2 21 92 1.0E-17
sp|Q2PFX4|H2B1K_MACFA Histone H2B type 1-K OS=Macaca fascicularis GN=HIST1H2BK PE=2 SV=3 15 92 1.0E-17
sp|P0CO02|H2B_CRYNJ Histone H2B OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HTB1 PE=3 SV=1 38 78 1.0E-17
sp|P0CO03|H2B_CRYNB Histone H2B OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HTB1 PE=3 SV=1 38 78 1.0E-17
sp|P33778|H2B1B_HUMAN Histone H2B type 1-B OS=Homo sapiens GN=HIST1H2BB PE=1 SV=2 15 92 1.0E-17
sp|P35068|H2B1_TIGCA Histone H2B.1/H2B.2 OS=Tigriopus californicus PE=3 SV=2 29 92 2.0E-17
sp|P06900|H2B12_XENLA Histone H2B 1.2 OS=Xenopus laevis PE=1 SV=2 15 92 2.0E-17
sp|Q64475|H2B1B_MOUSE Histone H2B type 1-B OS=Mus musculus GN=Hist1h2bb PE=1 SV=3 15 92 2.0E-17
sp|Q96A08|H2B1A_HUMAN Histone H2B type 1-A OS=Homo sapiens GN=HIST1H2BA PE=1 SV=3 16 78 3.0E-17
sp|Q8CGP2|H2B1P_MOUSE Histone H2B type 1-P OS=Mus musculus GN=Hist1h2bp PE=1 SV=3 15 92 3.0E-17
sp|Q00715|H2B1_RAT Histone H2B type 1 OS=Rattus norvegicus PE=1 SV=2 15 92 4.0E-17
sp|Q99879|H2B1M_HUMAN Histone H2B type 1-M OS=Homo sapiens GN=HIST1H2BM PE=1 SV=3 15 92 5.0E-17
sp|P35069|H2B3_TIGCA Histone H2B.3 OS=Tigriopus californicus PE=3 SV=2 29 92 5.0E-17
sp|P35067|H2B_ACRFO Histone H2B OS=Acropora formosa PE=3 SV=1 18 78 5.0E-17
sp|P93354|H2B_TOBAC Histone H2B OS=Nicotiana tabacum GN=HIS2B PE=2 SV=3 1 78 5.0E-17
sp|Q5RCP8|H2B2E_PONAB Histone H2B type 2-E OS=Pongo abelii GN=HIST2H2BE PE=2 SV=3 15 92 8.0E-17
sp|Q43215|H2B4_WHEAT Histone H2B.4 OS=Triticum aestivum GN=TH153 PE=1 SV=3 1 92 9.0E-17
sp|Q27894|H2B2_CAEEL Histone H2B 2 OS=Caenorhabditis elegans GN=his-4 PE=1 SV=3 36 83 1.0E-16
sp|Q9ZUS0|H2B4_ARATH Histone H2B.4 OS=Arabidopsis thaliana GN=At2g37470 PE=1 SV=3 1 92 1.0E-16
sp|Q27484|H2B3_CAEEL Probable histone H2B 3 OS=Caenorhabditis elegans GN=his-41 PE=3 SV=3 36 83 1.0E-16
sp|Q27876|H2B4_CAEEL Probable histone H2B 4 OS=Caenorhabditis elegans GN=his-48 PE=3 SV=3 36 78 1.0E-16
sp|P04255|H2B1_CAEEL Histone H2B 1 OS=Caenorhabditis elegans GN=his-11 PE=1 SV=4 36 78 1.0E-16
sp|Q32L48|H2B1N_BOVIN Histone H2B type 1-N OS=Bos taurus GN=HIST1H2BN PE=1 SV=3 15 92 2.0E-16
sp|P70696|H2B1A_MOUSE Histone H2B type 1-A OS=Mus musculus GN=Hist1h2ba PE=1 SV=3 16 92 2.0E-16
sp|P07795|H2BL2_PSAMI Late histone H2B.2.2 OS=Psammechinus miliaris PE=3 SV=2 34 78 2.0E-16
sp|P02287|H2BE1_PSAMI Histone H2B.1, embryonic OS=Psammechinus miliaris PE=3 SV=2 38 78 2.0E-16
sp|P02288|H2BE2_PSAMI Histone H2B.2, embryonic OS=Psammechinus miliaris PE=3 SV=2 38 78 3.0E-16
sp|Q9SI96|H2B3_ARATH Histone H2B.3 OS=Arabidopsis thaliana GN=At2g28720 PE=1 SV=3 1 92 4.0E-16
sp|P82887|H2B_OLILU Histone H2B OS=Olisthodiscus luteus PE=1 SV=2 44 92 5.0E-16
sp|P07794|H2BL1_PSAMI Late histone H2B.2.1 OS=Psammechinus miliaris PE=3 SV=2 34 78 6.0E-16
sp|Q6DRA6|H2B2D_HUMAN Putative histone H2B type 2-D OS=Homo sapiens GN=HIST2H2BD PE=5 SV=3 15 78 6.0E-16
sp|Q9LFF6|H2B8_ARATH Histone H2B.8 OS=Arabidopsis thaliana GN=At3g53650 PE=1 SV=3 1 78 7.0E-16
sp|Q00729|H2B1A_RAT Histone H2B type 1-A OS=Rattus norvegicus GN=Hist1h2ba PE=1 SV=2 17 92 8.0E-16
sp|O65819|H2B3_SOLLC Histone H2B.3 (Fragment) OS=Solanum lycopersicum GN=H2B-3 PE=2 SV=1 4 78 8.0E-16
sp|Q6DN03|H2B2C_HUMAN Putative histone H2B type 2-C OS=Homo sapiens GN=HIST2H2BC PE=5 SV=3 15 83 9.0E-16
sp|A3AGM4|H2B1_ORYSJ Histone H2B.1 OS=Oryza sativa subsp. japonica GN=H2B1 PE=1 SV=1 4 92 5.0E-15
sp|A2XF66|H2B1_ORYSI Histone H2B.1 OS=Oryza sativa subsp. indica GN=OsI_010709 PE=3 SV=1 4 92 5.0E-15
sp|P08994|H2B2_TETTS Histone H2B.2 OS=Tetrahymena thermophila (strain SB210) GN=HTB2 PE=1 SV=2 1 92 6.0E-15
sp|O23629|H2B6_ARATH Histone H2B.6 OS=Arabidopsis thaliana GN=H2B PE=1 SV=3 1 92 6.0E-15
sp|O97484|H2B_EUPCR Histone H2B OS=Euplotes crassus GN=H2B1 PE=3 SV=1 36 92 8.0E-15
sp|Q27442|H2B_ANOGA Histone H2B OS=Anopheles gambiae GN=AGAP012199 PE=2 SV=5 14 92 2.0E-14
sp|P40283|H2B11_ARATH Histone H2B.11 OS=Arabidopsis thaliana GN=At5g59910 PE=1 SV=5 6 92 2.0E-14
sp|Q9LZT0|H2B7_ARATH Histone H2B.7 OS=Arabidopsis thaliana GN=At3g46030 PE=1 SV=3 6 92 2.0E-14
sp|Q7M400|H2B_TETPY Histone H2B OS=Tetrahymena pyriformis PE=1 SV=2 37 92 3.0E-14
sp|P08993|H2B1_TETTS Histone H2B.1 OS=Tetrahymena thermophila (strain SB210) GN=HTB1 PE=1 SV=2 37 92 3.0E-14
sp|Q9LQQ4|H2B1_ARATH Histone H2B.1 OS=Arabidopsis thaliana GN=At1g07790 PE=1 SV=3 4 92 3.0E-14
sp|Q1S9I9|H2B1_MEDTR Probable histone H2B.1 OS=Medicago truncatula PE=3 SV=3 1 78 3.0E-14
sp|Q1SWQ1|H2B2_MEDTR Probable histone H2B.2 OS=Medicago truncatula PE=3 SV=3 1 78 3.0E-14
sp|O65821|H2B1_SOLLC Histone H2B.1 OS=Solanum lycopersicum GN=H2B-1 PE=2 SV=4 1 92 4.0E-14
sp|O22582|H2B_GOSHI Histone H2B OS=Gossypium hirsutum GN=HIS2B PE=2 SV=3 6 78 5.0E-14
sp|Q43261|H2B3_MAIZE Histone H2B.3 OS=Zea mays PE=3 SV=3 6 92 7.0E-14
sp|P16890|H2BL4_STRPU Late histone H2B.L4 (Fragment) OS=Strongylocentrotus purpuratus PE=1 SV=1 46 78 7.0E-14
sp|P06146|H2BS2_LYTPI Histone H2B.2, sperm OS=Lytechinus pictus PE=2 SV=3 46 78 8.0E-14
sp|P16889|H2BL3_STRPU Late histone H2B.L3 OS=Strongylocentrotus purpuratus PE=1 SV=3 46 83 1.0E-13
sp|O49118|H2B_CAPAN Histone H2B OS=Capsicum annuum GN=HIS2B PE=2 SV=3 1 78 2.0E-13
sp|P16888|H2BL1_STRPU Late histone H2B.L1 OS=Strongylocentrotus purpuratus PE=1 SV=2 46 78 2.0E-13
sp|P02292|H2BS3_PARAN Histone H2B.3, sperm OS=Parechinus angulosus PE=1 SV=2 46 93 2.0E-13
sp|Q43216|H2B5_WHEAT Histone H2B.5 OS=Triticum aestivum PE=1 SV=3 1 92 2.0E-13
sp|P16887|H2BS2_STRPU Histone H2B.2, sperm OS=Strongylocentrotus purpuratus PE=2 SV=2 46 92 2.0E-13
sp|P19374|H2B_PLADU Histone H2B OS=Platynereis dumerilii PE=3 SV=2 46 78 2.0E-13
sp|P27326|H2B_URECA Histone H2B OS=Urechis caupo PE=3 SV=2 46 83 2.0E-13
sp|P02291|H2BS2_PARAN Histone H2B.2, sperm OS=Parechinus angulosus PE=1 SV=2 46 93 2.0E-13
sp|P30757|H2B_SIPNU Histone H2B OS=Sipunculus nudus GN=H2B PE=1 SV=2 46 78 2.0E-13
sp|Q27750|H2BS2_PSAMI Histone H2B.2, sperm OS=Psammechinus miliaris PE=1 SV=3 46 93 2.0E-13
sp|P54345|H2B2_CHLRE Histone H2B.2 OS=Chlamydomonas reinhardtii PE=1 SV=3 46 78 2.0E-13
sp|P50565|H2B1_CHLRE Histone H2B.1 OS=Chlamydomonas reinhardtii GN=H2B PE=1 SV=3 46 78 3.0E-13
sp|P16867|H2B3_VOLCA Histone H2B.3 OS=Volvox carteri PE=3 SV=3 46 78 3.0E-13
sp|P02290|H2BS1_PARAN Histone H2B.1, sperm OS=Parechinus angulosus PE=1 SV=2 46 78 3.0E-13
sp|P16868|H2B4_VOLCA Histone H2B.4 OS=Volvox carteri PE=3 SV=3 46 78 3.0E-13
sp|Q27749|H2BS1_PSAMI Histone H2B.1, sperm OS=Psammechinus miliaris PE=1 SV=3 46 78 3.0E-13
sp|P02284|H2B_PATGR Histone H2B, gonadal OS=Patella granatina PE=1 SV=2 46 78 3.0E-13
sp|P54346|H2B3_CHLRE Histone H2B.3 OS=Chlamydomonas reinhardtii PE=1 SV=3 46 78 4.0E-13
sp|P54347|H2B4_CHLRE Histone H2B.4 OS=Chlamydomonas reinhardtii PE=1 SV=3 46 78 4.0E-13
sp|P02285|H2B_MARGL Histone H2B, sperm OS=Marthasterias glacialis PE=1 SV=2 46 78 4.0E-13
sp|P02286|H2B_ASTRU Histone H2B, gonadal OS=Asterias rubens PE=1 SV=2 46 83 4.0E-13
sp|Q8I1N0|H2B_DROYA Histone H2B OS=Drosophila yakuba GN=His2B PE=3 SV=3 46 83 4.0E-13
sp|Q76FD7|H2B_DROSE Histone H2B OS=Drosophila sechellia GN=His2B PE=3 SV=3 46 83 5.0E-13
sp|P17271|H2B_DROHY Histone H2B OS=Drosophila hydei GN=His2B PE=3 SV=2 46 83 5.0E-13
sp|Q76FF3|H2B_DROTE Histone H2B OS=Drosophila teissieri GN=His2B PE=3 SV=3 46 78 5.0E-13
sp|P59782|H2B_DROSI Histone H2B OS=Drosophila simulans GN=His2B PE=3 SV=2 46 78 5.0E-13
sp|Q76FE9|H2B_DROOR Histone H2B OS=Drosophila orena GN=His2B PE=3 SV=3 46 78 5.0E-13
sp|P02283|H2B_DROME Histone H2B OS=Drosophila melanogaster GN=His2B PE=1 SV=2 46 78 5.0E-13
sp|Q76FE5|H2B_DROMA Histone H2B OS=Drosophila mauritiana GN=His2B PE=3 SV=3 46 78 5.0E-13
sp|P59781|H2B_DROER Histone H2B OS=Drosophila erecta GN=His2B PE=3 SV=2 46 78 5.0E-13
sp|P06145|H2BS1_STRPU Histone H2B.1, sperm OS=Strongylocentrotus purpuratus PE=3 SV=2 46 78 5.0E-13
sp|Q9LGI2|H2B10_ORYSJ Histone H2B.10 OS=Oryza sativa subsp. japonica GN=H2B.10 PE=3 SV=1 20 92 8.0E-13
sp|A2WKS3|H2B10_ORYSI Histone H2B.10 OS=Oryza sativa subsp. indica GN=H2B.10 PE=3 SV=1 20 92 8.0E-13
sp|P14001|H2B_CAIMO Histone H2B OS=Cairina moschata PE=3 SV=2 46 78 8.0E-13
sp|P0C1H3|H2B1_CHICK Histone H2B 1/2/3/4/6 OS=Gallus gallus GN=H2B-I PE=1 SV=2 46 78 8.0E-13
sp|Q8CGP0|H2B3B_MOUSE Histone H2B type 3-B OS=Mus musculus GN=Hist3h2bb PE=1 SV=3 46 78 9.0E-13
sp|Q8N257|H2B3B_HUMAN Histone H2B type 3-B OS=Homo sapiens GN=HIST3H2BB PE=1 SV=3 46 78 9.0E-13
sp|Q9D2U9|H2B3A_MOUSE Histone H2B type 3-A OS=Mus musculus GN=Hist3h2ba PE=1 SV=3 46 78 1.0E-12
sp|Q94JE1|H2B5_ORYSJ Histone H2B.5 OS=Oryza sativa subsp. japonica GN=H2B.5 PE=3 SV=1 38 78 1.0E-12
sp|A2WKT4|H2B5_ORYSI Histone H2B.5 OS=Oryza sativa subsp. indica GN=H2B.5 PE=3 SV=1 38 78 1.0E-12
sp|Q9FFC0|H2B10_ARATH Histone H2B.10 OS=Arabidopsis thaliana GN=At5g22880 PE=1 SV=3 6 92 2.0E-12
sp|Q94JJ4|H2B4_ORYSJ Histone H2B.4 OS=Oryza sativa subsp. japonica GN=H2B.4 PE=3 SV=1 20 92 2.0E-12
sp|A2WKP5|H2B4_ORYSI Histone H2B.4 OS=Oryza sativa subsp. indica GN=H2B.4 PE=3 SV=1 20 92 2.0E-12
sp|Q94JJ7|H2B3_ORYSJ Histone H2B.3 OS=Oryza sativa subsp. japonica GN=H2B.3 PE=3 SV=1 20 92 2.0E-12
sp|A2WKP3|H2B3_ORYSI Histone H2B.3 OS=Oryza sativa subsp. indica GN=H2B.3 PE=3 SV=1 20 92 2.0E-12
sp|Q6ZBP3|H2B2_ORYSJ Histone H2B.2 OS=Oryza sativa subsp. japonica GN=H2B.2 PE=3 SV=1 46 92 2.0E-12
sp|A2YWI3|H2B2_ORYSI Histone H2B.2 OS=Oryza sativa subsp. indica GN=H2B.2 PE=3 SV=1 46 92 2.0E-12
sp|Q7M4G7|H2B_PATPE Histone H2B OS=Patiria pectinifera PE=1 SV=2 46 83 2.0E-12
sp|P27807|H2B1_WHEAT Histone H2B.1 OS=Triticum aestivum PE=1 SV=3 10 92 2.0E-12
sp|P30755|H2B1_MAIZE Histone H2B.1 OS=Zea mays PE=2 SV=3 46 92 2.0E-12
sp|P21897|H2B_CHITH Histone H2B OS=Chironomus thummi thummi PE=3 SV=2 46 78 2.0E-12
sp|Q43217|H2B3_WHEAT Histone H2B.3 OS=Triticum aestivum PE=1 SV=3 46 92 3.0E-12
sp|Q9LZ45|H2B9_ARATH Histone H2B.9 OS=Arabidopsis thaliana GN=At5g02570 PE=1 SV=3 1 78 3.0E-12
sp|Q9LGH8|H2B8_ORYSJ Histone H2B.8 OS=Oryza sativa subsp. japonica GN=H2B.8 PE=3 SV=1 46 92 4.0E-12
sp|A2WKS5|H2B8_ORYSI Histone H2B.8 OS=Oryza sativa subsp. indica GN=H2B.8 PE=3 SV=1 46 92 4.0E-12
sp|Q7GBK0|H2B7_ORYSJ Histone H2B.7 OS=Oryza sativa subsp. japonica GN=H2B.7 PE=2 SV=1 46 92 4.0E-12
sp|A2WKS8|H2B7_ORYSI Histone H2B.7 OS=Oryza sativa subsp. indica GN=H2B.7 PE=3 SV=1 46 92 4.0E-12
sp|A2WKT1|H2B6_ORYSI Histone H2B.6 OS=Oryza sativa subsp. indica GN=H2B.6 PE=3 SV=1 46 92 4.0E-12
sp|P49120|H2B4_MAIZE Histone H2B.4 OS=Zea mays PE=3 SV=3 46 78 6.0E-12
sp|Q943L2|H2B11_ORYSJ Histone H2B.11 OS=Oryza sativa subsp. japonica GN=H2B.11 PE=3 SV=1 46 78 6.0E-12
sp|A2WWU2|H2B11_ORYSI Histone H2B.11 OS=Oryza sativa subsp. indica GN=H2B.11 PE=3 SV=1 46 78 6.0E-12
sp|P30756|H2B2_MAIZE Histone H2B.2 OS=Zea mays PE=2 SV=3 46 78 7.0E-12
sp|P54348|H2B5_MAIZE Histone H2B.5 OS=Zea mays PE=2 SV=3 46 78 8.0E-12
sp|Q9LGH4|H2B6_ORYSJ Histone H2B.6 OS=Oryza sativa subsp. japonica GN=H2B.6 PE=3 SV=1 46 78 8.0E-12
sp|Q6F362|H2B9_ORYSJ Histone H2B.9 OS=Oryza sativa subsp. japonica GN=H2B.9 PE=3 SV=1 46 78 1.0E-11
sp|A2Y7R3|H2B9_ORYSI Histone H2B.9 OS=Oryza sativa subsp. indica GN=H2B.9 PE=3 SV=1 46 78 1.0E-11
sp|Q1SU99|H2B3_MEDTR Probable histone H2B.3 OS=Medicago truncatula PE=3 SV=3 46 78 5.0E-11
sp|O65818|H2B2_SOLLC Histone H2B.2 OS=Solanum lycopersicum GN=H2B-2 PE=2 SV=2 46 78 5.0E-11
sp|Q99285|H2B_PEA Histone H2B (Fragments) OS=Pisum sativum GN=HIS2B PE=1 SV=2 39 91 8.0E-11
sp|Q9SF55|H2B5_ARATH Histone H2B.5 OS=Arabidopsis thaliana GN=At3g09480 PE=1 SV=3 1 78 2.0E-10
sp|Q9SGE3|H2B2_ARATH Histone H2B.2 OS=Arabidopsis thaliana GN=At1g08170 PE=2 SV=1 48 83 2.0E-07
sp|Q41575|H2B6_WHEAT Histone H2B.6 OS=Triticum aestivum GN=TH123 PE=1 SV=3 1 70 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5191
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1951
Ophiocordyceps australis map64 (Brazil) OphauB2|5435
Ophiocordyceps camponoti-floridani Ophcf2|03257
Ophiocordyceps camponoti-rufipedis Ophun1|7215 (this protein)
Ophiocordyceps kimflemingae Ophio5|234
Ophiocordyceps subramaniannii Hirsu2|3988

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7215
MPPKAADKKPAAKAPATASKAPEKKDAGKKTATSGDKKKRSKTRKETYSSYIYKVLKQVHPDTGISNRAMSILNS
FVNGKIVRTNPVSTLTSC*
Coding >Ophun1|7215
ATGCCTCCCAAAGCCGCCGACAAGAAGCCTGCGGCCAAGGCTCCCGCAACTGCGAGCAAGGCACCTGAGAAGAAG
GATGCTGGGAAGAAAACAGCCACATCTGGCGACAAGAAGAAGCGTTCCAAAACGCGCAAGGAGACTTACAGCTCA
TACATCTACAAAGTGCTGAAGCAAGTTCATCCTGACACCGGTATCTCTAATCGTGCCATGTCCATCCTCAACTCC
TTTGTCAACGGTAAGATTGTCCGAACCAATCCGGTTTCGACGCTAACTTCGTGCTAG
Transcript >Ophun1|7215
ATGCCTCCCAAAGCCGCCGACAAGAAGCCTGCGGCCAAGGCTCCCGCAACTGCGAGCAAGGCACCTGAGAAGAAG
GATGCTGGGAAGAAAACAGCCACATCTGGCGACAAGAAGAAGCGTTCCAAAACGCGCAAGGAGACTTACAGCTCA
TACATCTACAAAGTGCTGAAGCAAGTTCATCCTGACACCGGTATCTCTAATCGTGCCATGTCCATCCTCAACTCC
TTTGTCAACGGTAAGATTGTCCGAACCAATCCGGTTTCGACGCTAACTTCGTGCTAG
Gene >Ophun1|7215
ATGCCTCCCAAAGCCGCCGACAAGAAGCCTGCGGCCAAGGCTCCCGCAACTGCGAGCAAGGCACCTGAGAAGAAG
GATGCTGGGAAGAAAACAGCCACATCTGGCGACAAGAAGAAGCGTTCCAAAACGCGCAAGGAGACTTACAGCTCA
TACATCTACAAAGGTTTGTCACGCCGGCCGCTACAGGAAGCGGACTCTCTGATGCTAAAATGTATGATCACAGTG
CTGAAGCAAGTTCATCCTGACACCGGTATCTCTAATCGTGCCATGTCCATCCTCAACTCCTTTGTCAACGGTAAG
ATTGTCCGAACCAATCCGGTTTCGACGCTAACTTCGTGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail