Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7213
Gene name
LocationContig_877:3801..5729
Strand-
Gene length (bp)1928
Transcript length (bp)1632
Coding sequence length (bp)1632
Protein length (aa) 544

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 4.9E-40 25 477
PF00083 Sugar_tr Sugar (and other) transporter 9.0E-08 34 170

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P25351|YCR3_YEAST Uncharacterized membrane protein YCR023C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR023C PE=1 SV=2 17 514 9.0E-73
sp|Q3EAQ5|PTR36_ARATH Probable peptide/nitrate transporter At3g43790 OS=Arabidopsis thaliana GN=ZIFL2 PE=2 SV=2 30 489 4.0E-41
sp|Q94BZ1|ZIFL1_ARATH Protein ZINC INDUCED FACILITATOR-LIKE 1 OS=Arabidopsis thaliana GN=ZIFL1 PE=2 SV=1 17 485 8.0E-40
sp|Q8RWN2|ZIF1_ARATH Protein ZINC INDUCED FACILITATOR 1 OS=Arabidopsis thaliana GN=ZIF1 PE=1 SV=2 38 485 6.0E-37
sp|B4EYY4|MDTG_PROMH Multidrug resistance protein MdtG OS=Proteus mirabilis (strain HI4320) GN=mdtG PE=3 SV=1 20 310 9.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P25351|YCR3_YEAST Uncharacterized membrane protein YCR023C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR023C PE=1 SV=2 17 514 9.0E-73
sp|Q3EAQ5|PTR36_ARATH Probable peptide/nitrate transporter At3g43790 OS=Arabidopsis thaliana GN=ZIFL2 PE=2 SV=2 30 489 4.0E-41
sp|Q94BZ1|ZIFL1_ARATH Protein ZINC INDUCED FACILITATOR-LIKE 1 OS=Arabidopsis thaliana GN=ZIFL1 PE=2 SV=1 17 485 8.0E-40
sp|Q8RWN2|ZIF1_ARATH Protein ZINC INDUCED FACILITATOR 1 OS=Arabidopsis thaliana GN=ZIF1 PE=1 SV=2 38 485 6.0E-37
sp|B4EYY4|MDTG_PROMH Multidrug resistance protein MdtG OS=Proteus mirabilis (strain HI4320) GN=mdtG PE=3 SV=1 20 310 9.0E-10
sp|D8MQN9|MDTG_ERWBE Multidrug resistance protein MdtG OS=Erwinia billingiae (strain Eb661) GN=mdtG PE=3 SV=1 20 174 6.0E-08
sp|Q14728|MFS10_HUMAN Major facilitator superfamily domain-containing protein 10 OS=Homo sapiens GN=MFSD10 PE=1 SV=1 61 173 4.0E-07
sp|P02982|TCR1_ECOLX Tetracycline resistance protein, class A OS=Escherichia coli GN=tetA PE=3 SV=2 18 171 4.0E-07
sp|Q0P5M9|MFS10_BOVIN Major facilitator superfamily domain-containing protein 10 OS=Bos taurus GN=MFSD10 PE=2 SV=1 61 209 6.0E-07
sp|A8GCZ5|MDTG_SERP5 Multidrug resistance protein MdtG OS=Serratia proteamaculans (strain 568) GN=mdtG PE=3 SV=1 35 174 7.0E-07
sp|Q9D2V8|MFS10_MOUSE Major facilitator superfamily domain-containing protein 10 OS=Mus musculus GN=Mfsd10 PE=1 SV=1 61 183 7.0E-07
sp|P02981|TCR3_ECOLX Tetracycline resistance protein, class C OS=Escherichia coli GN=tetA PE=1 SV=1 55 183 3.0E-06
sp|P51563|TCR7_VIBAN Tetracycline resistance protein, class G OS=Vibrio anguillarum GN=tetA PE=3 SV=1 56 221 5.0E-06
sp|P51564|TCR8_PASMD Tetracycline resistance protein, class H OS=Pasteurella multocida GN=tetA PE=3 SV=1 82 184 6.0E-06
sp|P02980|TCR2_ECOLX Tetracycline resistance protein, class B OS=Escherichia coli GN=tetA PE=1 SV=1 39 171 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.5

Transmembrane Domains

Domain # Start End Length
1 22 44 22
2 59 81 22
3 93 112 19
4 122 144 22
5 151 173 22
6 195 217 22
7 307 329 22
8 365 387 22
9 394 416 22
10 426 448 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7213
MRGGSGAGKGSGQAVPFPTQQMFVLACCRICEPIAFMSIFPYIYYMIEDFHIARDASQISVYAGMVTSAFTLAEF
ATGVMWGRLSDKIGRKPVLLTGLLGTALSVLAFGFAPNLPVALGARALGGLLNGNIGVLQTTVAELVTVREQQPR
AYTIMPMVWCIGSIIGPIIGGALARPCISYPDLFPRGTIWDRFPYLLPNLFSAAAVLVGVVIGILFLDETHADKK
LQRDHGRELGRRLVALFRRATVCKYREKQGLLVLPDSKRDAYGACGSVRDEPLPAYRSRENSPKLSPQAIRAPTT
TGPSKAVVFTRPVIMNIISYGILAFHTMTFDQLFPVFLSTSPLQHPIRELPFKFADGFGLDTKTIGVVMSCQGVY
SLLSNFVIVPPVTRRLGSLRLFRMLAFSYFALYVITPYLVLLPEDVRMPAVYALVIWKCTYATMAYPNNAILLAN
SAPSKQVLGTINGVAASTASLCRALGPTLSGVLYAVGLKTGYSGLAWWFSGLVTIVGAYLSSQITETQPPPAEEE
VEEALLDDALLYSEDEAV*
Coding >Ophun1|7213
ATGAGAGGAGGAAGCGGTGCCGGAAAGGGGTCCGGCCAGGCGGTGCCCTTTCCCACGCAGCAGATGTTCGTTCTA
GCCTGCTGCCGGATTTGCGAGCCCATCGCCTTCATGTCCATCTTCCCTTACATCTACTACATGATCGAGGACTTT
CACATCGCCCGCGACGCCAGCCAAATCTCCGTCTACGCCGGCATGGTGACGTCGGCCTTCACCCTGGCCGAGTTC
GCGACGGGCGTCATGTGGGGGCGCTTAAGTGACAAGATCGGCCGGAAGCCCGTGCTGTTGACCGGTCTGCTGGGC
ACTGCCCTGAGCGTGCTGGCCTTTGGATTCGCCCCGAACCTGCCCGTTGCTCTGGGAGCCCGCGCGCTCGGCGGC
CTCCTGAACGGGAACATCGGCGTCCTGCAGACGACCGTGGCCGAGTTGGTGACGGTGAGGGAGCAGCAGCCTCGG
GCCTATACTATCATGCCCATGGTGTGGTGCATTGGCTCCATCATCGGCCCCATCATCGGAGGCGCTCTGGCTCGG
CCATGCATCAGCTATCCGGATCTGTTTCCGCGAGGCACCATCTGGGATCGCTTTCCTTACCTGCTGCCCAACTTG
TTCAGTGCCGCCGCCGTCCTGGTCGGTGTCGTTATCGGCATCCTGTTCCTGGACGAGACGCACGCCGACAAGAAG
CTGCAGAGGGATCACGGCCGTGAGCTCGGACGCCGCCTGGTAGCTCTGTTCCGTCGTGCCACCGTCTGCAAGTAC
CGTGAGAAGCAGGGTCTTCTCGTCCTTCCCGACTCGAAAAGGGACGCATATGGTGCATGTGGCAGCGTCCGGGAC
GAGCCGCTGCCTGCATATCGCAGCCGTGAGAACTCGCCCAAGCTGTCGCCTCAGGCCATCCGCGCGCCCACGACG
ACCGGTCCCTCCAAGGCGGTTGTCTTTACCCGGCCCGTCATCATGAATATTATTTCCTACGGCATCCTGGCATTC
CATACCATGACGTTTGACCAGCTCTTCCCCGTCTTTCTCAGCACTTCGCCGCTTCAGCATCCCATCCGCGAGCTC
CCTTTCAAGTTCGCCGACGGCTTCGGTCTCGACACCAAGACCATTGGCGTCGTCATGTCGTGTCAGGGCGTGTAC
TCGCTGCTGTCCAACTTTGTCATCGTTCCTCCGGTCACGAGACGGCTCGGCTCACTCCGGCTCTTCCGCATGCTC
GCCTTTTCCTACTTTGCCCTCTACGTCATTACGCCCTATCTGGTGCTCCTGCCTGAAGACGTGCGGATGCCGGCC
GTCTACGCCCTCGTCATCTGGAAGTGCACCTACGCCACCATGGCTTACCCGAACAACGCCATTCTGCTGGCCAAC
TCTGCTCCCAGCAAGCAAGTTCTGGGCACCATCAACGGCGTGGCGGCGTCGACGGCCAGTCTGTGTCGCGCCCTG
GGACCCACGCTCTCAGGAGTCCTGTACGCCGTCGGGCTGAAGACGGGATACTCTGGCCTCGCCTGGTGGTTCAGC
GGACTGGTGACGATTGTGGGCGCGTACCTGAGCTCACAAATCACCGAGACACAGCCTCCTCCAGCGGAAGAAGAG
GTGGAGGAGGCGCTACTGGACGACGCGCTTCTCTACAGCGAGGACGAGGCCGTATGA
Transcript >Ophun1|7213
ATGAGAGGAGGAAGCGGTGCCGGAAAGGGGTCCGGCCAGGCGGTGCCCTTTCCCACGCAGCAGATGTTCGTTCTA
GCCTGCTGCCGGATTTGCGAGCCCATCGCCTTCATGTCCATCTTCCCTTACATCTACTACATGATCGAGGACTTT
CACATCGCCCGCGACGCCAGCCAAATCTCCGTCTACGCCGGCATGGTGACGTCGGCCTTCACCCTGGCCGAGTTC
GCGACGGGCGTCATGTGGGGGCGCTTAAGTGACAAGATCGGCCGGAAGCCCGTGCTGTTGACCGGTCTGCTGGGC
ACTGCCCTGAGCGTGCTGGCCTTTGGATTCGCCCCGAACCTGCCCGTTGCTCTGGGAGCCCGCGCGCTCGGCGGC
CTCCTGAACGGGAACATCGGCGTCCTGCAGACGACCGTGGCCGAGTTGGTGACGGTGAGGGAGCAGCAGCCTCGG
GCCTATACTATCATGCCCATGGTGTGGTGCATTGGCTCCATCATCGGCCCCATCATCGGAGGCGCTCTGGCTCGG
CCATGCATCAGCTATCCGGATCTGTTTCCGCGAGGCACCATCTGGGATCGCTTTCCTTACCTGCTGCCCAACTTG
TTCAGTGCCGCCGCCGTCCTGGTCGGTGTCGTTATCGGCATCCTGTTCCTGGACGAGACGCACGCCGACAAGAAG
CTGCAGAGGGATCACGGCCGTGAGCTCGGACGCCGCCTGGTAGCTCTGTTCCGTCGTGCCACCGTCTGCAAGTAC
CGTGAGAAGCAGGGTCTTCTCGTCCTTCCCGACTCGAAAAGGGACGCATATGGTGCATGTGGCAGCGTCCGGGAC
GAGCCGCTGCCTGCATATCGCAGCCGTGAGAACTCGCCCAAGCTGTCGCCTCAGGCCATCCGCGCGCCCACGACG
ACCGGTCCCTCCAAGGCGGTTGTCTTTACCCGGCCCGTCATCATGAATATTATTTCCTACGGCATCCTGGCATTC
CATACCATGACGTTTGACCAGCTCTTCCCCGTCTTTCTCAGCACTTCGCCGCTTCAGCATCCCATCCGCGAGCTC
CCTTTCAAGTTCGCCGACGGCTTCGGTCTCGACACCAAGACCATTGGCGTCGTCATGTCGTGTCAGGGCGTGTAC
TCGCTGCTGTCCAACTTTGTCATCGTTCCTCCGGTCACGAGACGGCTCGGCTCACTCCGGCTCTTCCGCATGCTC
GCCTTTTCCTACTTTGCCCTCTACGTCATTACGCCCTATCTGGTGCTCCTGCCTGAAGACGTGCGGATGCCGGCC
GTCTACGCCCTCGTCATCTGGAAGTGCACCTACGCCACCATGGCTTACCCGAACAACGCCATTCTGCTGGCCAAC
TCTGCTCCCAGCAAGCAAGTTCTGGGCACCATCAACGGCGTGGCGGCGTCGACGGCCAGTCTGTGTCGCGCCCTG
GGACCCACGCTCTCAGGAGTCCTGTACGCCGTCGGGCTGAAGACGGGATACTCTGGCCTCGCCTGGTGGTTCAGC
GGACTGGTGACGATTGTGGGCGCGTACCTGAGCTCACAAATCACCGAGACACAGCCTCCTCCAGCGGAAGAAGAG
GTGGAGGAGGCGCTACTGGACGACGCGCTTCTCTACAGCGAGGACGAGGCCGTATGA
Gene >Ophun1|7213
ATGAGAGGAGGAAGCGGTGCCGGAAAGGGGTCCGGCCAGGCGGTGCCCTTTCCCACGCAGCAGATGTTCGTTCTA
GGTAGGTAACGGGGAGTTGGTTGAGGTTATGGATCATGATCAAGAGTTGGAGGCTGATTGTTTAGCCTGCTGCCG
GATTTGCGAGCCCATCGCCTTCATGTCCATCTTCCCTTACATCTACTACATGATCGAGGACTTTCACATCGCCCG
CGACGCCAGCCAAATCTCCGTCTACGCCGGCATGGTGACGTCGGCCTTCACCCTGGCCGAGTTCGCGACGGGCGT
CATGTGGGGGCGCTTAAGTGACAAGATCGGCCGGAAGCCCGTGCTGTTGACCGGTCTGCTGGGCACTGCCCTGAG
CGTGCTGGCCTTTGGATTCGCCCCGAACCTGCCCGTTGCTCTGGGAGCCCGCGCGCTCGGCGGCCTCCTGAACGG
GTATGCCGTCTTTTCTTTTTTAAATGTTTGCTTCTTCGCTGACCTTGGCCTCGTGACAGGAACATCGGCGTCCTG
CAGACGACCGTGGCCGAGTTGGTGACGGTGAGGGAGCAGCAGCGTGAGTGCCCAATTCGCCCCCGGCGGCCAATC
CCCTGCTGACGTCTGCCACGCAGCTCGGGCCTATACTATCATGCCCATGGTGTGGTGCATTGGGTGCGTCCCCCC
TTGCCCTTGTGTGTGTGTATGTGTTGGAAACCTTCTCATGCCCTGACGCAGCTCCATCATCGGCCCCATCATCGG
AGGCGCTCTGGCTCGGCCATGCATCAGCTATCCGGATCTGTTTCCGCGAGGCACCATCTGGGATCGCTTTCCTTA
CCTGCTGCCCAACTTGTTCAGTGCCGCCGCCGTCCTGGTCGGTGTCGTTATCGGCATCCTGTTCCTGGACGAGAC
GCACGCCGACAAGAAGCTGCAGAGGGATCACGGCCGTGAGCTCGGACGCCGCCTGGTAGCTCTGTTCCGTCGTGC
CACCGTCTGCAAGTACCGTGAGAAGCAGGGTCTTCTCGTCCTTCCCGACTCGAAAAGGGACGCATATGGTGCATG
TGGCAGCGTCCGGGACGAGCCGCTGCCTGCATATCGCAGCCGTGAGAACTCGCCCAAGCTGTCGCCTCAGGCCAT
CCGCGCGCCCACGACGACCGGTCCCTCCAAGGCGGTTGTCTTTACCCGGCCCGTCATCATGAATATTATTTCCTA
CGGCATCCTGGCATTGTGCGTGATTACACCCTTTATCCGTCTGTCACTACTGAGCTAACATCATCACCAGCCATA
CCATGACGTTTGACCAGCTCTTCCCCGTCTTTCTCAGCACTTCGCCGCTTCAGCATCCCATCCGCGAGCTCCCTT
TCAAGTTCGCCGACGGCTTCGGTCTCGACACCAAGACCATTGGCGTCGTCATGTCGTGTCAGGGCGTGTACTCGC
TGCTGTCCAACTTTGTCATCGTTCCTCCGGTCACGAGACGGCTCGGCTCACTCCGGCTCTTCCGCATGCTCGCCT
TTTCCTACTTTGCCCTCTACGTCATTACGCCCTATCTGGTGCTCCTGCCTGAAGACGTGCGGATGCCGGCCGTCT
ACGCCCTCGTCATCTGGAAGTGCACCTACGCCACCATGGCTTACCCGAACAACGCCATTCTGCTGGCCAACTCTG
CTCCCAGCAAGCAAGTTCTGGGCACCATCAACGGCGTGGCGGCGTCGACGGCCAGTCTGTGTCGCGCCCTGGGAC
CCACGCTCTCAGGAGTCCTGTACGCCGTCGGGCTGAAGACGGGATACTCTGGCCTCGCCTGGTGGTTCAGCGGAC
TGGTGACGATTGTGGGCGCGTACCTGAGCTCACAAATCACCGAGACACAGCCTCCTCCAGCGGAAGAAGAGGTGG
AGGAGGCGCTACTGGACGACGCGCTTCTCTACAGCGAGGACGAGGCCGTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail